Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031918 (Mtmr2)
Chromosomal location
Chr 9: 13552863 - 13610925 (+)
Description
myotubularin related protein 2 Gene [Source:MGI Symbol;Acc:MGI:1924366]
RefSeq_peptide
NP_076347.3 
UniGene
Mm.472556 Mm.464709 
MGI
MGI:1924366 
Uniprot/SWISSPROT
Q9Z2D1 
Uniprot/SPTREMBL
Q5DU01 Q3V030 Q3V415 Q6P572 
Human Ortholog
ENSG00000087053 (MTMR2)
Omim 601382 - CHARCOT-MARIE-TOOTH DISEASE, TYPE 4B1  
UniTrap UNI3822
Vector Insertion
Chr 9: 13553845 - 13586720
Public Clones AZ0083 (sanger) E123F10 (ggtc) IST14502H5 (tigm)
Private Clones OST150599 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27273
Vector Insertion
Chr 9: 13586827 - 13590295
Public Clones IST13264D7 (tigm)
Private Clones OST65258 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15905
Vector Insertion
Chr 9: 13607983 - 13609249
Public Clones not available
Private Clones OST470465 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088508
Sequence
GTTGTGTGTTTTCTTTTCATCTTGCAGGACCCCCCATTTGTTCTAGATGCTTCTCTTGGAGTGATAAGTAGAGTAGAAAAAATTGGTGGTGCATCTAGCC

GAGGTGAAAACTCCTATGGCCTGGAAACTGTGTGCAAG GATATCAGGAACTTGCGATTTGCTCATAAACCGGAGGGGCGAACAAGAAGATCCATATTTG

AGAATCTAATGAAATATGCATTTCCTGTGTCTAATGGCTTG CCTCTTTTTGCTTTTGAGTATAAAGAAGTATTCCCCGAAAATGGGTGGAAACTGTATG

ACCCCCTTCTAGAGTACAGAAGGCAG GGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGCTATGAACTCTGTGACACATATCCTGCCC

TCTTGGTTGTGCCAGCAAACATTCCTGATGAGGAGCTAAAGAGAGTGGCATCCTTTAGGTCACGGGGCCGGATCCCAGTAAGTAGGCTGAGTAGGTATAT

CCACAG TCATTTTAAAACTTGTTTTCAGCTCATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTCGAGTCTGGGAAGACGTCTGTGGTGGTACACTG

CAGTGATGGATGGGATCGCACAGCTCAGCTCACTTCCCTGGCCATGCTCATGTTGGATGGATACTACCGAACCATACGAGGATTTGAAGTCCTTGTGGAG

AAAGAATGGCTGAGCTTTGGACATAGATTCCAACTA AGAGTTGGCCATGGAGATAAGAACCATGCTGACGCAGACAGGTCACCTGTTTTCCTTCAGTTT

ATTGACTGTGTCTGGCAAATGACAAGACAG TTCCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATCCTGGACCACTTGTACAGCTGTTTA

TTTGGAACATTCCTTTGTAACAGCGAACAGCAGAGGGGGAAAGAG - UNI15905 - AATCTTCCTAAGAAGACAGTGTCACTGTGGTCCTATATAAA

CAGCCAGCTGGAAGACTTTACTAATCCTCTTTATGGAAGCTACTCCAATCATGTCCTTTACCCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGA

TATTATATAAGGTGGAACCCCCGGATGAAACCTCAG GAACCTATCCACAGCAGATACAAAGAACTTCTTGCCAAAAGAGCAGAGCTTCAAAGAAAAGTA

GAGGAACTTCAGAGAGAAATTTCCAACCGCTCAACCTCCTCTTCAGAGAGAGCCAGCTCTCCTGCACAGTGTGTGACTCCTGTCCAAACTGTTGTATGAA

AGGACTAGGCCCAGGGCCTCATTGCCAGGAACCTGACATTCCAGCACCTTATGGGTAGAAAACCTTCCGTGTTTAAAACCCATCTACTGGAGAATCCTTC

GGATGCTGTATTTATTTCAAATCTCTCTTAGATGAGTTTAGAAACATAGCAGTGCAAGTGACAATGAAGATGATCTCATTCATAATTAAAGTATGACACT

AATCTTAAGTCACCCAAAGAATACTAAAGTACTGCAGTCCTGTATTCACACTGGGAGCAAGTTTTTCATTTAAAAATGTCTTAAAACCCTGAGCACCTGG

TCAGATCTCCAGGAGGGGAGAAAAGCAAGGCCACCTGCTGTTGCACCTGAGAGCACACGCATTGAGGCTTGTGTCAGATCCAAATATTCCTTTCTCAGTT

TCCCCAAGTTTTGTGATATTTAATATAGTAAAAAGCATTGTCTTGAGATTATTATGGCATAGTAGGTTTTTTTTTTTTTTTTTTTTTTGCTGCTGACATT

GTAATTAGCATATTCTCAACAGCAATTAGGAAACAATGCCTTATATATGTGCTTTGGGGGGTTGAAGGGACAAAGTAGTAGCTGTCATCTACTCCATTTG

TGTATTGATCACAAACATCACAGAAGACATCTTAAAACCTTACTGTTACTCTACTTTATCTAAATGCTATTTGGCAAGTTTTAAGACAGTATTTTAAAAA

CTTAGAAGTCTGACTTTATGTGCTGTGTAAATCTCACATGGACACTTTACCAAAGAGCACTCTGCATGAGTTAGTCTCAGTGCCAGCAAGTAAAGCCTTG

CTTCTCTGCTCACCCGAGTCCGGTGCTGGTGGGGACAGTTGACTCCTGGGGTCTGTTTTACTCTGTACAAGAGCCATATGTAATGTACTGTAACAAACGA

GCTTCTTACCACTTGGTCTTTTAATTAAATGACTTCAAACTTTG
Translation
VVCFLFILQDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCK DIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNGL PLFAFEYKEVFPENGWKL

YDPLLEYRRQ GIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVSRLSRYIHS SHFKTCFQLILAGALRIADKVESGKTSV

VVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQL RVGHGDKNHADADRSPVFLQFIDCVWQMTRQ FPTAFEFNEYFLITILDH

LYSCLFGTFLCNSEQQRGKE - UNI15905 - NLPKKTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQ EPIHSR

YKELLAKRAELQRKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
Transcript ENSMUST00000034396
Sequence
GATTTTAGCAGCTTCTCCCTCATTCTCACTTCAATACTTACTATGCCTTATAGGTTGGTGTCAATGTGCTTATCAGCTACAGACACACTTTCAAGCCACT

TTAACCCATACTTTTGTCACTGGAGGCCTGAAAATTCAACTCCATTCTCACTTTCCTTTGTATAACGCTGTTCAGAGATGGAAATTTCCCTTCCCCTCCC

CATTCAGGGTAGCTGTTACTATCTTTCTCCTACAAACCACTTGTTAGTGGTCTGTCATCCTTTAGTTTTCTTTCATTAACAGTTACCATTTATTAAGTTT

GTTAGGTTGTTTATATATTGACTACTGTCTGAGTGCTTAAGCAGGCATTGCTTTAGGCGTTTTATATTTATCAATAGTTATTCTGTGAGGTTAATATACT

TACACAGAAGGAAGCAGATGTAAATGCAAGGTAACTGGAGGCCGTGGGATCAGTCTGCTTAGCTTCACTGTTACCGTTACAAAATGGGTTCTCACATCAC

GTATGATCTCACATCACTACTTCTAACCTCACCCTTAAATACCTCACCCCCTCATCCCACAGGCCGCCCACATTCCTCTCATTTTCCTCGAGTCCACCTC

TCCCAAGCCGTCACATCTTGTGTTTTCTCTGACATACTAGTGTCCTCTTCCTTCTGGAGATTTTCCTGTTAGCTGACTCTCACTGGGCGGCCAGGCGCAT

GCGCATCGCTCCGCTTTGTAGCGCCACGGGGCCCGACTCCCGACAGCCCCCGCGCGCAGTGCAGGCTGGGGGAACATGGCCGCTTCCGGTCTCGGAGCCT

GCCTGGCGCGGGGCTGACCGCGGCTGCGGCCCCGTGCGCTCCTCCCTCTGCATCTCGCGCCGGCGGCCGCGGAGGGCGCAGCGGCCTCCAGTTTCTCGCG

CCATGGAGAAGAGCTCCAGCTGCGAGAGTCTCGGCGCGCAGCTCCCGGCGGCAAGGCTGCCCAGCGAGGACTCACTGTCCAG - UNI3822 - TGCTT

CTACTTCTCATTCAGAGAACTCGGTGCATACCAAATCAGCTTCTGCTATATCATCAGATTCCATTTCAACCTCTGCAGACAACTTTTCTCCTGACTTGAG

G - UNI27273 - GTCCTGAGGGAGGCAAACAAGTTAGCAGAAATGGAGGAACCAGCCCTGCTTCCAGGAGAGAACATTAAAGATATGG CCAAAGAT

GTGACTTACATATGTCCATTCACTGGTGCTGTGCGAGGAACGCTGACTGTCACAAGTTACAGGTTATATTTCAAGAGCATGGAGCGG GACCCCCCATTT

GTTCTAGATGCTTCTCTTGGAGTGATAAGTAGAGTAGAAAAAATTGGTGGTGCATCTAGCCGAGGTGAAAACTCCTATGGCCTGGAAACTGTGTGCAAG 

GATATCAGGAACTTGCGATTTGCTCATAAACCGGAGGGGCGAACAAGAAGATCCATATTTGAGAATCTAATGAAATATGCATTTCCTGTGTCTAATGGCT

TG CCTCTTTTTGCTTTTGAGTATAAAGAAGTATTCCCCGAAAATGGGTGGAAACTGTATGACCCCCTTCTAGAGTACAGAAGGCAG GGAATTCCAAAT

GAAAGCTGGAGAATAACAAAGATAAATGAACGCTATGAACTCTGTGACACATATCCTGCCCTCTTGGTTGTGCCAGCAAACATTCCTGATGAGGAGCTAA

AGAGAGTGGCATCCTTTAGGTCACGGGGCCGGATCCCA GTTTTATCCTGGATTCATCCTGAAAGTCAAGCCACAGTCACTCGCTGCAGCCAGCCCATGG

TTGGAGTGAGTGGGAAGCGCAGCAAAGAAGATGAGAAGTACCTTCAGGCCATCATGGACTCCAATGCCCAGTCTCACAAAATATTTATCTTTGATGCTCG

GCCAAGTGTCAATGCGGTTGCCAATAAG GCAAAGGGGGGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCAGAACTCGTTTTTCTGGATATTCATAA

TATCCATGTTATGAGAGAATCATTACGGAAGCTTAAGGAGATTGTGTACCCCACCATTGAAGAAACTCACTGGTTGTCTAACTTAGAATCTACACACTGG

CTGGAACACATTAAG CTCATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTCGAGTCTGGGAAGACGTCTGTGGTGGTACACTGCAGTGATGGATGG

GATCGCACAGCTCAGCTCACTTCCCTGGCCATGCTCATGTTGGATGGATACTACCGAACCATACGAGGATTTGAAGTCCTTGTGGAGAAAGAATGGCTGA

GCTTTGGACATAGATTCCAACTA AGAGTTGGCCATGGAGATAAGAACCATGCTGACGCAGACAGGTCACCTGTTTTCCTTCAGTTTATTGACTGTGTCT

GGCAAATGACAAGACAG TTCCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATCCTGGACCACTTGTACAGCTGTTTATTTGGAACATTCC

TTTGTAACAGCGAACAGCAGAGGGGGAAAGAG - UNI15905 - AATCTTCCTAAGAAGACAGTGTCACTGTGGTCCTATATAAACAGCCAGCTGGAA

GACTTTACTAATCCTCTTTATGGAAGCTACTCCAATCATGTCCTTTACCCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGATATTATATAAGGT

GGAACCCCCGGATGAAACCTCAG GAACCTATCCACAGCAGATACAAAGAACTTCTTGCCAAAAGAGCAGAGCTTCAAAGAAAAGTAGAGGAACTTCAGA

GAGAAATTTCCAACCGCTCAACCTCCTCTTCAGAGAGAGCCAGCTCTCCTGCACAGTGTGTGACTCCTGTCCAAACTGTTGTATGAAAGGACTAGGCCCA

GGGCCTCATTGCCAGGAACCTGACATTCCAGCACCTTATGGGTAGAAAACCTTCCGTGTTTAAAACCCATCTACTGGAGAATCCTTCGGATGCTGTATTT

ATTTCAAATCTCTCTTAGATGAGTTTAGAAACATAGCAGTGCAAGTGACAATGAAGATGATCTCATTCATAATTAAAGTATGACACTAATCTTAAGTCAC

CCAAAGAATACTAAAGTACTGCAGTCCTGTATTCACACTGGGAGCAA
Translation
MEKSSSCESLGAQLPAARLPSEDSLSS - UNI3822 - SASTSHSENSVHTKSASAISSDSISTSADNFSPDLR - UNI27273 - VLREANKLAE

MEEPALLPGENIKDMA AKDVTYICPFTGAVRGTLTVTSYRLYFKSMER DPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCK DIRNLRFAHKPE

GRTRRSIFENLMKYAFPVSNGL PLFAFEYKEVFPENGWKLYDPLLEYRRQ GIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGR

IP VLSWIHPESQATVTRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANK AKGGGYESEDAYQNAELVFLDIHNIHVMRESLR

KLKEIVYPTIEETHWLSNLESTHWLEHIK LILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQL 

RVGHGDKNHADADRSPVFLQFIDCVWQMTRQ FPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKE - UNI15905 - NLPKKTVSLWSYINSQ

LEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQ EPIHSRYKELLAKRAELQRKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
Transcript ENSMUST00000115652
Sequence
GATTTTAGCAGCTTCTCCCTCATTCTCACTTCAATACTTACTATGCCTTATAGGTTGGTGTCAATGTGCTTATCAGCTACAGACACACTTTCAAGCCACT

TTAACCCATACTTTTGTCACTGGAGGCCTGAAAATTCAACTCCATTCTCACTTTCCTTTGTATAACGCTGTTCAGAGATGGAAATTTCCCTTCCCCTCCC

CATTCAGGGTAGCTGTTACTATCTTTCTCCTACAAACCACTTGTTAGTGGTCTGTCATCCTTTAGTTTTCTTTCATTAACAGTTACCATTTATTAAGTTT

GTTAGGTTGTTTATATATTGACTACTGTCTGAGTGCTTAAGCAGGCATTGCTTTAGGCGTTTTATATTTATCAATAGTTATTCTGTGAGGTTAATATACT

TACACAGAAGGAAGCAGATGTAAATGCAAGGTAACTGGAGGCCGTGGGATCAGTCTGCTTAGCTTCACTGTTACCGTTACAAAATGGGTTCTCACATCAC

GTATGATCTCACATCACTACTTCTAACCTCACCCTTAAATACCTCACCCCCTCATCCCACAGGCCGCCCACATTCCTCTCATTTTCCTCGAGTCCACCTC

TCCCAAGCCGTCACATCTTGTGTTTTCTCTGACATACTAGTGTCCTCTTCCTTCTGGAGATTTTCCTGTTAGCTGACTCTCACTGGGCGGCCAGGCGCAT

GCGCATCGCTCCGCTTTGTAGCGCCACGGGGCCCGACTCCCGACAGCCCCCGCGCGCAGTGCAGGCTGGGGGAACATGGCCGCTTCCGGTCTCGGAGCCT

GCCTGGCGCGGGGCTGACCGCGGCTGCGGCCCCGTGCGCTCCTCCCTCTGCATCTCGCGCCGGCGGCCGCGGAGGGCGCAGCGGCCTCCAGTTTCTCGCG

CCATGGAGAAGAGCTCCAGCTGCGAGAGTCTCGGCGCGCAGCTCCCGGCGGCAAGGCTGCCCAGCGAGGACTCACTGTCCAG - UNI3822 - TGCTT

CTACTTCTCATTCAGAGAACTCGGTGCATACCAAATCAGCTTCTGCTATATCATCAGATTCCATTTCAACCTCTGCAGACAACTTTTCTCCTGACTTGAG

G - UNI27273 - GTCCTGAGGGAGGCAAACAAGTTAGCAGAAATGGAGGAACCAGCCCTGCTTCCAGGAGAGAACATTAAAGATATGG CCAAAGAT

GTGACTTACATATGTCCATTCACTGGTGCTGTGCGAGGAACGCTGACTGTCACAAGTTACAGGTTATATTTCAAGAGCATGGAGCGG GACCCCCCATTT

GTTCTAGATGCTTCTCTTGGAGTGATAAGTAGAGTAGAAAAAATTGGTGGTGCATCTAGCCGAGGTGAAAACTCCTATGGCCTGGAAACTGTGTGCAAG 

GATATCAGGAACTTGCGATTTGCTCATAAACCGGAGGGGCGAACAAGAAGATCCATATTTGAGAATCTAATGAAATATGCATTTCCTGTGTCTAATGGCT

TG CCTCTTTTTGCTTTTGAGTATAAAGAAGTATTCCCCGAAAATGGGTGGAAACTGTATGACCCCCTTCTAGAGTACAGAAGGCAG GGAATTCCAAAT

GAAAGCTGGAGAATAACAAAGATAAATGAACGCTATGAACTCTGTGACACATATCCTGCCCTCTTGGTTGTGCCAGCAAACATTCCTGATGAGGAGCTAA

AGAGAGTGGCATCCTTTAGGTCACGGGGCCGGATCCCA GTTTTATCCTGGATTCATCCTGAAAGTCAAGCCACAGTCACTCGCTGCAGCCAGCCCATGG

TTGGAGTGAGTGGGAAGCGCAGCAAAGAAGATGAGAAGTACCTTCAGGCCATCATGGACTCCAATGCCCAGTCTCACAAAATATTTATCTTTGATGCTCG

GCCAAGTGTCAATGCGGTTGCCAATAAG GCAAAGGGGGGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCAGAACTCGTTTTTCTGGATATTCATAA

TATCCATGTTATGAGAGAATCATTACGGAAGCTTAAGGAGATTGTGTACCCCACCATTGAAGAAACTCACTGGTTGTCTAACTTAGAATCTACACACTGG

CTGGAACACATTAAG CTCATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTCGAGTCTGGGAAGACGTCTGTGGTGGTACACTGCAGTGATGGATGG

GATCGCACAGCTCAGCTCACTTCCCTGGCCATGCTCATGTTGGATGGATACTACCGAACCATACGAGGATTTGAAGTCCTTGTGGAGAAAGAATGGCTGA

GCTTTGGACATAGATTCCAACTA AGAGTTGGCCATGGAGATAAGAACCATGCTGACGCAGACAGGTCACCTGTTTTCCTTCAGTTTATTGACTGTGTCT

GGCAAATGACAAGACAG TTCCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATCCTGGACCACTTGTACAGCTGTTTATTTGGAACATTCC

TTTGTAACAGCGAACAGCAGAGGGGGAAAGAG - UNI15905 - AATCTTCCTAAGAAGACAGTGTCACTGTGGTCCTATATAAACAGCCAGCTGGAA

GACTTTACTAATCCTCTTTATGGAAGCTACTCCAATCATGTCCTTTACCCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGATATTATATAAGGT

GGAACCCCCGGATGAAACCTCAG GAACCTATCCACAGCAGATACAAAGAACTTCTTGCCAAAAGAGCAGAGCTTCAAAGAAAAGTAGAGGAACTTCAGA

GAGAAATTTCCAACCGCTCAACCTCCTCTTCAGAGAGAGCCAGCTCTCCTGCACAGTGTGTGACTCCTGTCCAAACTGTTGTATGAAAGGACTAGGCCCA

GGGCCTCATTGCCAGGAACCTGACATTCCAGCACCTTATGGGTAGAAAACCTTCCGTGTTTAAAACCCATCTACTGGAGAATCCTTCGGATGCTGTATTT

ATTTCAAATCTCTCTTAGATGAGTTTAGAAACATAGCAGTGCAAGTGACAATGAAGATGATCTCATTCATAATTAAAGTATGACACTAATCTTAAGTCAC

CCAAAGAATACTAAAGTACTGCAGTCCTGTATTCACACTGGGAGCAA
Translation
MRIAPLCSATGPDSRQPPRAVQAGGTWPLPVSEPAWRGADRGCGPVRSSLCISRRRPRRAQRPPVSRAMEKSSSCESLGAQLPAARLPSEDSLSS - UN

I3822 - SASTSHSENSVHTKSASAISSDSISTSADNFSPDLR - UNI27273 - VLREANKLAEMEEPALLPGENIKDMA AKDVTYICPFTGAVR

GTLTVTSYRLYFKSMER DPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCK DIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNGL PLFAFEYKE

VFPENGWKLYDPLLEYRRQ GIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIP VLSWIHPESQATVTRCSQPMVGVSGKRSK

EDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANK AKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPTIEETHWLSNLESTHWLEHIK LI

LAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQL RVGHGDKNHADADRSPVFLQFIDCVWQMTRQ 

FPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKE - UNI15905 - NLPKKTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGY

YIRWNPRMKPQ EPIHSRYKELLAKRAELQRKVEELQREISNRSTSSSERASSPAQCVTPVQTVV

For any suggestions or comments, please send an email to unitrap@crg.es