Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031922 (Cep57)
Chromosomal location
Chr 9: 13612227 - 13631433 (-)
Description
centrosomal protein 57 Gene [Source:MGI Symbol;Acc:MGI:1915551]
RefSeq_peptide
NP_080941.3 
UniGene
Mm.157212 
MGI
MGI:1915551 
Uniprot/SWISSPROT
Q8CEE0 
Uniprot/SPTREMBL
A0PJD7 
Human Ortholog
ENSG00000166037 (CEP57)
Omim not available
UniTrap UNI21475
Vector Insertion
Chr 9: 13626128 - 13631299
Public Clones (sanger) E025G03 (ggtc) D106B04 (ggtc)
Private Clones OST329348 (lexicon) OST316338 (lexicon) OST258023 (lexicon) OST139094 (lexicon)
OST126926 (lexicon) OST58868 (lexicon) OST50138 (lexicon) OST36629 (lexicon)
OST36610 (lexicon) OST34137 (lexicon) OST32658 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23188
Vector Insertion
Chr 9: 13623483 - 13625970
Public Clones not available
Private Clones OST272697 (lexicon) OST195066 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4161
Vector Insertion
Chr 9: 13617965 - 13620498
Public Clones AM0798 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034398
Sequence
GGACTTGGATTCCGCTTGCCCCAGGCGGGCGGCTGTCGAATCCGGAGGAGGAGCTCAAGGACGGCGTCTGGGGTTGCGCAGGTGGGAAGATGGCGGCAGC

CTCGGTCTCGGCGGCTTCTGATTCTCAGTTTTCG - UNI21475 - AGCGTCCTAGCTGAACCATCAAGGTCTAATGGAAATATGGTTCGTCATTCTT

CGTCTCCATATGTATTGTATCCACCTGATAAGCCTTTCCTTAACAGTGATCTGAGACGCTCCCCAAATAAGCCCACATTTGCCTATCCGGAAAGCAACAG

CAGAG - UNI23188 - CCATATTTTCTGCTCTTAAGAATCTTCAAGATAAGATTCGACGCCTGGAACTGGAAAGGATTCAGGCAGAAGAAAGTGTGA

AAACCTTGTCTAGGGAAACCATTGAGTACAAGAAAGTATTGGATGAACAGATCCAAGAGAGGGAGAACTCAAAGAATGAAGAATCAAAGCACAATCAAG 

AACTGGCATCCCAGTTGGTAGCTGCAGAAAATAAATGTAATCTTCTAGAAAAACAATTGGAATACATGCGAAATATGATAAAGCATGCAGAAATGGAGAG

GACATCTGTGTTAGAAAAGCAG GTTTCTCTAGAAAGAGAACGGCAGCATGATCAAACCCATGTTCAGAGCCAGCTGGAAAAACTGGATCTTCTTGAACA

GGAATACAACAAACTCACCGCCATGCAGGCCCTTGCAGAA AAAAAGATGCAGGAGTTGGAGTCCAAACTCCGTGAAGAAGAGCAGGAAAGGAAGCGGAT

GCAGGCCCGGGCAGCAGAG - UNI4161 - TTACAGAGTGGTCTAGAAGCAAATAGACTTATTTTTGAAGATAAGACTACTTCATGTGTTTCAACCAG

CACTAGAAAAATAAAAAAAAAGAAGTCAAAACCACCAGAAAAG AAAGGTTCTAGGACCTATTTTGGTGCACAGCCACATTACAGATTGTGCTTAGGTGA

TATGCCTTTTGTTGCTGGAACG TCCACCAGTCCCAGCCATGCCGTGGTAGCCAATGTTCAGCATGTCTTGCATCTGATGAAACACCACAGTAAAGCCCT

GTGCAATGATCGAGTTGTTAACAGTGTTCCCTTGGCAAAGCAAGCTTGCTCACGAGTTAGTAAGAGTAAGAAGTCAGTGGTGCCTCCTTCCAGCAGTGTT

AATGAAGAACTTTCGGATGTCTTGCAGACTTTACAGGATGAATTTGGGCAAATGAGCTT TGATCATCAGCAGCTTACTAAACTCATACAGGAATCACCA

ACTGTGGAACTAAAAGACAACCTGGAGTGTGAATTGGAGGCATTAGTGGGAAGAATGGAAGCGAAGGCCAATCAGATAACTAAAGTTCGAAAATACCAAG

CCCAG CTGGAGAAACAAAACATAGATAAGCAGAAGAAGGAATTAAAAGCTAACAAAAAGACTCTTGATGAAGAAGGGAACAGCAGCGGTCGTTCATCTG

GAGTCCCAAGGACCGCAAGTAAGAAGGATCTGGCCAAACAGAGACCTGGAGAAAAAAGCAGGAAAAATCTTCAGTTACTGAAGGACATGCAGACCATACA

GAATTCACTGCAGAGCAGTAATCTGTGTTGGGATTACTGACACCAGGTCATAAATGATGTACCTCACTGGTCATAAACGATGTACGTACTGGACATGAGC

AGACTTTCCAGGTCTCATGCTTGCTAAGCTGCCATTACTGGCAGGTGTTAGGGGCCAAGCTTCATTACAGTCTATTGTGCTATGTAGCACAACTGATGGA

GATGGAGTTCTGCGGCAGAGAAGCCTCACTGTCTTTGAATTTGCTGTACTCATTCACTGCACTTTGTAAACAAATGACCAGTTTTTTACTCATGGGTGTG

TTTTTTAAACTAGGTATATATGTAAATTGGGTTTGAAAATTCAGAATATGAGATAGTCCCCATAGTCAGTGCTTGAAGTCTTGTTTTTTAAATCTTCCCA

CAGCATGAAGTGACCACTACTCTCCCTTCTCCAGATGACCATTAAATGTACTGTTTTCAAGAAGACTTTGTTTTGCTTTGGTATTTTAGACATTGATCAA

TCATAAATTCACTTAAGTCAGTTATCCATGAAATATGTCACAATGTCTTCAGAAAAACTATATAAACAGTTGTTACTGAAGTAAATGAAATTTTGGAATA

AAGAATGAGAACGTGGGTATTGTAAAATGTACACGTTTACAGTTTTTAGACAGTATCTATTTGTAATCATGTTAAGCACTGTTTAATCTTGACTTAAGAG

AAGCTCATGCTTTTAGCATACAGTATGTGAATTGAATACACACATCTATCATGCCAATGTAAATTATTTAACTTTGAGTAGATCGACATGTTATAATCTT

TATAAATTTGGTACTTCAAATCAATAAAGCAGTTTTTAAACTTTGCTTAACAGCCAGCTAACAA
Translation
MAAASVSAASDSQFS - UNI21475 - SVLAEPSRSNGNMVRHSSSPYVLYPPDKPFLNSDLRRSPNKPTFAYPESNSRA - UNI23188 - AIFS

ALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE ELASQLVAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQ 

VSLERERQHDQTHVQSQLEKLDLLEQEYNKLTAMQALAE KKMQELESKLREEEQERKRMQARAAE - UNI4161 - LQSGLEANRLIFEDKTTSCVS

TSTRKIKKKKSKPPEK KGSRTYFGAQPHYRLCLGDMPFVAGT STSPSHAVVANVQHVLHLMKHHSKALCNDRVVNSVPLAKQACSRVSKSKKSVVPPS

SSVNEELSDVLQTLQDEFGQMSF FDHQQLTKLIQESPTVELKDNLECELEALVGRMEAKANQITKVRKYQAQ LEKQNIDKQKKELKANKKTLDEEGNS

SGRSSGVPRTASKKDLAKQRPGEKSRKNLQLLKDMQTIQNSLQSSNLCWDY

For any suggestions or comments, please send an email to unitrap@crg.es