Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031930 (Wwp2)
Chromosomal location
Chr 8: 109960317 - 110081112 (+)
Description
WW domain containing E3 ubiquitin protein ligase 2 Gene [Source:MGI Symbol;Acc:MGI:1914144]
RefSeq_dna
NM_025830 
RefSeq_peptide
NP_080106.1 
UniGene
Mm.390058 
MGI
MGI:1914144 
Uniprot/SWISSPROT
Q9DBH0 
Uniprot/SPTREMBL
Q3TXI7 Q9CT73 
Human Ortholog
ENSG00000198373 (WWP2)
Omim not available
UniTrap UNI11412
Vector Insertion
Chr 8: 109960342 - 109976878
Public Clones (sanger) E069G04 (ggtc) D127E06 (ggtc) M123A07 (ggtc) D143H06 (ggtc)
D050G07 (ggtc) 3SE286A03 (ggtc) D136B04 (ggtc) D050F07 (ggtc) D182D08 (ggtc)
D117D12 (ggtc) M122D07 (ggtc) D143G04 (ggtc) M125F11 (ggtc) D054B02 (ggtc)
5SE286A03 (ggtc) FHCRC-GT-S6-1E1 (fhcrc) IST14573H1 (tigm) IST14070H8 (tigm)
IST10982D5 (tigm) IST14537D9 (tigm) IST14120A8 (tigm) IST13428F11 (tigm)
IST10118E7BBR1 (tigm) IST14493H4 (tigm) IST13361A3 (tigm) IST13839H2 (tigm)
IST14593C3 (tigm) IST14285A3 (tigm) IST12830A12 (tigm) IST10458A3 (tigm)
IST13213H4 (tigm) IST13252E9 (tigm) IST14566C6 (tigm) IST10519E10 (tigm)
IST10491F4 (tigm) IST14477E11 (tigm) IST14500A1 (tigm) IST10166D5 (tigm)
IST14021D7 (tigm) IST12049G3 (tigm) IST11754D6 (tigm) IST14156E4 (tigm)
IST11989F2 (tigm) IST14575D10 (tigm) IST10038H3 (tigm) IST10890D10 (tigm)
IST15088D10 (tigm) IST10982E3 (tigm) IST13339G11 (tigm) IST15005A1 (tigm)
IST14505H1 (tigm) IST10402G3 (tigm) IST12023G1 (tigm) IST10083C9 (tigm)
IST14857H6 (tigm) IST14681G3 (tigm) IST13076B11 (tigm) IST14717A5 (tigm)
IST14353D5 (tigm) IST10920A9 (tigm) IST14737D3 (tigm) IST14137A12 (tigm)
IST10004C3 (tigm) IST14918B7 (tigm) IST10073G3 (tigm) IST14953D6 (tigm)
IST12332C10 (tigm) IST10018B5 (tigm) IST10698B4 (tigm) IST12496H8 (tigm)
IST10282H12 (tigm) IST14938E5 (tigm) IST14961G8 (tigm) IST10524F7BBF1 (tigm)
IST11485H4 (tigm) IST11687D8 (tigm) IST14645G9 (tigm) IST14393H7 (tigm)
IST10305E3 (tigm) IST14070H7 (tigm) IST13181B6 (tigm) IST14643B5 (tigm)
IST14421H4 (tigm) IST13202F4 (tigm) IST14593E4 (tigm) IST13202F1 (tigm)
IST12112F6 (tigm) IST14595G12 (tigm) IST14116A8 (tigm) IST14561H4 (tigm)
IST14501G9 (tigm) IST11198B4 (tigm) IST10206G7 (tigm) IST14635B5 (tigm)
IST10922E5 (tigm) IST11704H9 (tigm) IST11385A3 (tigm) IST10082C11 (tigm)
Private Clones OST438026 (lexicon) OST419695 (lexicon) OST374401 (lexicon) OST370920 (lexicon)
OST369460 (lexicon) OST367583 (lexicon) OST364593 (lexicon) OST360828 (lexicon)
OST350951 (lexicon) OST333329 (lexicon) OST321274 (lexicon) OST315570 (lexicon)
OST312084 (lexicon) OST311025 (lexicon) OST307313 (lexicon) OST300263 (lexicon)
OST293260 (lexicon) OST284231 (lexicon) OST280264 (lexicon) OST276968 (lexicon)
OST275680 (lexicon) OST274965 (lexicon) OST261905 (lexicon) OST246267 (lexicon)
OST243837 (lexicon) OST238506 (lexicon) OST237637 (lexicon) OST236754 (lexicon)
OST236574 (lexicon) OST225403 (lexicon) OST216038 (lexicon) OST215609 (lexicon)
OST215077 (lexicon) OST212026 (lexicon) OST211528 (lexicon) OST207995 (lexicon)
OST207821 (lexicon) OST204462 (lexicon) OST204060 (lexicon) OST203738 (lexicon)
OST202134 (lexicon) OST198273 (lexicon) OST189264 (lexicon) OST187045 (lexicon)
OST184848 (lexicon) OST179379 (lexicon) OST170870 (lexicon) OST165850 (lexicon)
OST164833 (lexicon) OST158482 (lexicon) OST151051 (lexicon) OST148296 (lexicon)
OST146085 (lexicon) OST145733 (lexicon) OST134019 (lexicon) OST128324 (lexicon)
OST127411 (lexicon) OST108153 (lexicon) OST104830 (lexicon) OST104567 (lexicon)
OST102560 (lexicon) OST101004 (lexicon) OST98814 (lexicon) OST90801 (lexicon)
OST85061 (lexicon) OST77181 (lexicon) OST73155 (lexicon) OST65766 (lexicon)
OST62216 (lexicon) OST52373 (lexicon) OST45370 (lexicon) OST43587 (lexicon)
OST40259 (lexicon) OST34083 (lexicon) OST33665 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6716
Vector Insertion
Chr 8: 109976964 - 109981342
Public Clones HMA140 (baygenomics) (ggtc)
Private Clones OST442868 (lexicon) OST440799 (lexicon) OST422956 (lexicon) OST297213 (lexicon)
OST236487 (lexicon) OST231661 (lexicon) OST224411 (lexicon) OST219417 (lexicon)
OST218334 (lexicon) OST214122 (lexicon) OST124175 (lexicon) OST90496 (lexicon)
OST80423 (lexicon) OST34197 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI340
Vector Insertion
Chr 8: 109981491 - 109981779
Public Clones GC0919 (tigem)
Private Clones OST426654 (lexicon) OST379699 (lexicon) OST376573 (lexicon) OST313671 (lexicon)
OST311832 (lexicon) OST242530 (lexicon) OST217368 (lexicon) OST185058 (lexicon)
OST115479 (lexicon) OST106837 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI437
Vector Insertion
Chr 8: 109981902 - 110007231
Public Clones DD0419 (sanger) CSD099 (baygenomics)
Private Clones OST226817 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3091
Vector Insertion
Chr 8: 110007370 - 110009445
Public Clones DC0164 (sanger)
Private Clones OST213506 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16388
Vector Insertion
Chr 8: 110009543 - 110030206
Public Clones (sanger) E029F12 (ggtc) D106A11 (ggtc) D113G07 (ggtc) IST15092B8 (tigm)
Private Clones OST461862 (lexicon) OST421345 (lexicon) OST366623 (lexicon) OST323609 (lexicon)
OST56867 (lexicon) OST32010 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10004
Vector Insertion
Chr 8: 110030335 - 110041800
Public Clones XE089 (baygenomics) XE279 (baygenomics) A048A01 (ggtc) FHCRC-GT-S6-6F1 (fhcrc)
IST12570G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11722
Vector Insertion
Chr 8: 110042012 - 110057099
Public Clones P029H06 (ggtc) D094D08 (ggtc) E114F05 (ggtc) CMHD-GT_326H4-3 (cmhd)
Private Clones OST293250 (lexicon) OST33577 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034407
Sequence
GGCGCCGCTGGTGTGGCCGCGGCAG - UNI11412 - TTCCATTGTGATGACATGGCATCTGCCAGCTCCAGCCGGGCAGGAGTGGCCCTGCCTTTTG

AGAAGTCCCAGCTTACCCTGAAAG - UNI6716 - TGGTGTCAGCAAAGCCCAAGGTGCACAACCGCCAGCCCAGAATCAACTCCTACGTGGAGGTGG

CAGTGGATGGACTCCCCAGCGAGACCAAGAAGACGGGGAAGCGCATCGGGAGCTCTGAACTGCTCTGGAATGAAATCATCGTTCT - UNI340 - GAA

TGTCACAGCCCAGAGTCATTTGGATCTGAAGGTCTGGAGCTGTCATACCTTGAGGAATGAACTACTGGGCACTGCCTCTGTCAACCTCTCCAATGTCCTG

AAGAACAATGGCGGCAAAA - UNI437 - TGGAGAACACACAACTGACCCTGAACCTGCAGACAGAGAACAAAGGCAGTGTTGTCTCGGGAGGAGAGC

TGACAATTTTCCTGGATGGGCCAACTGTTGATCTGGGAAGTGTGCCTAATGGCAGTGCAGTGACAGACG - UNI3091 - GATCACAGCCACCTTCAA

GAGAATCCAGTGGGACTGCTATAGCTCCAGAGACCCGGCACCAGCCCCCCAGTACAAACTGCTTTGGTGGCAGATCCCG - UNI16388 - GACGCAC

AGACACTCAGGTGGCTCAGCCAGGACAGCCACAGCAGCCAGTGAACAAAGCCCTGGCGCTAGGAACCGCCACCGCCAGCCTGTGAAGAACTCTAGCAGCA

GTGGCTTAGCCAATGGCACAG - UNI10004 - TGAATGAGGAACCTACTCCAGCCAGTGAACCTGAAGAATCGTCGGTTGTTGGTGTAACATCCCTG

CCTGCAGCAGCCTTGAGTGTGTCCTCAAATCCCAACACAACATCTCTCCCTGCACAGTCCACACCAGCAGAGGGAGAGGAGGCCAGCACTTCCGGGACAC

AGCAGCTCCCTGCTGCCGCCCAGGCCCCTGATGCTCTTCCTGCTGG - UNI11722 - ATGGGAACAGAGAGAGCTGCCCAATGGGCGTGTCTATTAT

GTTGATCACAACACCAAGACCACCACCTGGGAGCGGCCTCTTCCTCCAGG GTGGGAAAAGCGCACGGACCCCCGAGGGAGGTTTTACTACGTGGACCAC

AACACCCGGACAACCACCTGGCAGCGCCCAACTGCTGAGTACGTGCGCAACTATGAGCAGTGGCAGTCCCAGCGGAACCAGCTGCAGGGGGCCATGCAGC

ACTTCAGCCAAAGATTCCTCTACCAG TCTTCGAGTGCTTCGACTGACCATGATCCCTTGGGCCCCCTCCCACCTGGCTGGG AGAAGAGGCAGGACAAT

GGACGGGTGTATTATGTCAACCACAACACTCGCACTACCCAGTGGGAGGACCCTCGGACCCAGGG GATGATACAGGAGCCAGCCCTGCCCCCAGGGTGG

GAGATGAAATACACCAGCGAGGGCGTGCGGTACTTTGTGGACCACAATACCCGCACCACTACCTTTAAGGATCCTCGCCCAGGGTTCGAGTCAGG GACA

AAGCAAGGCTCACCTGGTGCCTATGACCGAAGTTTTCGGTGGAAGTATCACCAGTTCCGTTTCCTCTGCCAC TCAAATGCTCTACCCAGCCATGTGAAG

ATCAGCGTTTCCAGGCAGACACTCTTTGAGGATTCTTTCCAACAG ATTATGAACATGAAACCTTACGACCTGCGCCGCCGGCTCTACATCATCATGCGT

GGTGAGGAGGGCCTGGACTACGGCGGCATCGCCAG AGAGTGGTTTTTCCTCCTGTCCCATGAGGTGCTCAACCCTATGTACTGTTTGTTTGAATATGCT

GGGAAGAACAATTACTGCCTGCAGATCAACCCGGCCTCTTCCATCAACCCTGACCACCTCACCTACTTCCGCTTTATCGGCAGATTCATCGCCATG GCT

CTGTACCATGGGAAGTTCATCGACACAGGCTTCACTCTCCCTTTCTACAAGCGGATGCTCAACAAGAGACCGACTCTGAAGGACCTGGAGTCTATTGACC

CTGAGTTTTACAACTCCATTGTCTGGATCAA AGAGAACAACCTGGAAGAGTGTGGTCTGGAGCTGTTTTTCATCCAGGACATGGAGATTCTGGGCAAGG

TGACAACCCATGAACTGAAGGAGGGCGGTGAGAACATCCGAGTTACCGAGGAGAACAAGGAGGAGTATATCAT GCTGCTGACTGACTGGCGATTCACCC

GAGGCGTGGAAGAGCAGACCAAAGCTTTCCTGGATGGCTTCAATGAGGTTGCCCCTCTGGAGTGGTTGAGATATTTTGATGAGAAAGAGCTGGAG CTCA

TGCTCTGCGGCATGCAGGAGATAGACATGAGCGACTGGCAGAAGAACGCCATCTATCGGCACTACACCAAGAGCAGCAAGCAGATCCAGTGGTTCTGGCA

G GTTGTCAAGGAGATGGACAATGAGAAGAGGATCCGGCTACTGCAGTTTGTCACGGGAACCTGCCGTCTGCCTGTTGGGGGATTTGCTGAGCTCATCG 

GGAGCAATGGCCCGCAGAAGTTCTGCATCGACAGAGTTGGCAAGGAAACCTGGCTGCCCAGGAGCCATACGTG CTTCAACCGTCTGGACCTGCCTCCCT

ATAAGAGCTACGAGCAGCTGAAAGAGAAGCTGCTGTACGCCATCGAGGAGACTGAGGGGTTCGGACAGGAGTAGCTGAGGCTGCTGTCTCACACCCTCTA

GCACATGTAGTCCTGAGTCCTTCCTGCCGGAGATGCCACCGGTTGCACAGCCCTCAAGAGGCCCCTTTGGATAGTGGCCCTGCACGAGACTGTGCCTTGA

TCATTTCGGTGACTGAAGAGTCTGACCCCAGAGGCCTTGGGGACCCTTTCTTCTCTCTGATGATGGCAGTCTGGAATAAAGCACTGTCACCTTTGACTCT

Translation
 - UNI11412 - MASASSSRAGVALPFEKSQLTLKV - UNI6716 - VVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIV

L - UNI340 - LNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKM - UNI437 - MENTQLTLNLQTENKGSVVSGGELTIFLDGPTV

DLGSVPNGSAVTDG - UNI3091 - GSQPPSRESSGTAIAPETRHQPPSTNCFGGRSR - UNI16388 - RTHRHSGGSARTATAASEQSPGARNR

HRQPVKNSSSSGLANGTV - UNI10004 - VNEEPTPASEPEESSVVGVTSLPAAALSVSSNPNTTSLPAQSTPAEGEEASTSGTQQLPAAAQAPDAL

PAG - UNI11722 - GWEQRELPNGRVYYVDHNTKTTTWERPLPPG GWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQH

FSQRFLYQ SSSASTDHDPLGPLPPGWE EKRQDNGRVYYVNHNTRTTQWEDPRTQG GMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE

SG GTKQGSPGAYDRSFRWKYHQFRFLCH SNALPSHVKISVSRQTLFEDSFQQ IMNMKPYDLRRRLYIIMRGEEGLDYGGIAR REWFFLLSHEVLNP

MYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAM ALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIK KENNLEECGLELF

FIQDMEILGKVTTHELKEGGENIRVTEENKEEYIM MLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELE LMLCGMQEIDMSDWQKNAIYRH

YTKSSKQIQWFWQ VVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIG GSNGPQKFCIDRVGKETWLPRSHTC CFNRLDLPPYKSYEQLKEKLLYAIEE

TEGFGQE

For any suggestions or comments, please send an email to unitrap@crg.es