Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031949 (Adat1)
Chromosomal location
Chr 8: 114492306 - 114516148 (-)
Description
adenosine deaminase, tRNA-specific 1 Gene [Source:MGI (curated);Acc:Adat1-002]
RefSeq_dna
NM_013925 
RefSeq_peptide
NP_038953.1 
UniGene
Mm.282162 
MGI
MGI:1353631 
Uniprot/SWISSPROT
Q9JHI2 
Human Ortholog
ENSG00000065457 (ADAT1)
Omim not available
UniTrap UNI24679
Vector Insertion
Chr 8: 114514104 - 114514313
Public Clones not available
Private Clones OST210158 (lexicon) OST188978 (lexicon) OST39222 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38563
Vector Insertion
Chr 8: 114514104 - 114516149
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3626
Vector Insertion
Chr 8: 114502039 - 114503198
Public Clones BC0140 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35790
Vector Insertion
Chr 8: 114495452 - 114502039
Public Clones IST10903F4 (tigm) IST12653D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21577
Vector Insertion
Chr 8: 114492445 - 114495452
Public Clones not available
Private Clones OST325503 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120457
Sequence
ATTTGGCTTTCTATAGTGGCCTCAGCTCCAGCTCCACCTATGTGGACCGCGGATGAGATCGCTCAGCTGTGCTATGCACACTATAACGTCAGACTGCCCA

AGCAGGGGAAGCCTGAGCCAAATCGTGAGTGGACCTTGCTGGCAGCTGTGGTGAAGATTCAGGCTTCAGCTAACCAAGCTTGTGACATCCCTGAGAAGGA

AGTGCAAG - UNI24679 - TGACAAAGGAAGTTGTCTCAATGGGAACAGGAACAAAATGCATAGGCCAGTCCAAGATGCGAGAGAGCG GGGACATC

CTCAATGACAGCCATGCTGAGATCATAGCCAGAAGGAGTTTCCAGAG ATACCTTCTCCATCAGCTCCATTTGGCAGCCGTCCTGAAAGAGGATAGCATC

TTTGTTCCAGGGACCCAAAGAGGACTGTGGAGGCTCAGACCTGACCTGTCGTTTGTGTTTTTCTCTAGCCACACACCCT GTGGGGATGCCTCCATCATC

CCGATGCTCGAGTTTGAAGAACAGCCTTGCTGTCCTGTCATCAGAAGTTGGGCCAACAACTCACCTGTACAAGAGACTGAGAATCTAGAGGATTCTAAAG

ATAAAAGGAACTGTGAAGATCCCGCCAGTCCTGTAGCCAAGAAGATGAGGCTGGGAACACCTGCCAGGTCACTCTCCAATTGTGTAGCTCACCATGGGAC

CCAGGAAAGTGGTCCAGTCAAACCAGATGTCAGCAGCTCTGATCTCACCAAGGAGGAACCAGATGCTGCCAATGGAATAGCTTCAGGTAGCTTCAGAGTG

GTGGATGTGTACAGGACGGGAGCCAAGTGTGTTCCTGGAGAAACTGGAGACTTGAGAGAGCCAGGTGCTGCCTACCACCAGGTGGGGCTACTTCGTGTAA

AACCTGGCAGGGGAGACAGGACATGCTCCATGTCCTGCAGTGACAAGATGGCAAGGTGGAATGTCCTCGGATGCCAGGGCGCACTGCTGATGCACTTCCT

GGAGAAGCCTATCTACCTGTCAGCTGTGGTCATCGGGAAGTGCCCGTACAGCCAGGAAGCCATGAGGAGAGCATTGACTGGCAG - UNI3626 - - U

NI35790 - GATCATTCCAGAAGCTGCTGAGCAGCATTGCAGATGACGAGCAGCCAGACTCCATCAGGTGATATTGTCTGTCCCTCTGTCCTCCTGTCT

GTAAAGATTTCTCCTCTGGTTCTAGCTTATGTTTGGTGAGCTTATTAGGCTCAGTGAGCCAGTGGGTGCTTACTGCTTACCCAGAGAGAATGGGAAGTTG

TCAGATTTGTGTCAGGGTCAGTTAGAGGAAAGGCTGTTCATGCAGGAAGGGGAAGGGGAAGGTTGGGTTTTCATCTTACACATTTATTTACTTGATTTGA

GATAGGATCTCATTGCTCAGGTTGGCCTGAAACGAAAACTCACAGTTTACGCCAGCTTAAGCTCAAACCCAGAGCAGTTTGCCGGCTTCCGCCTCCCACG

TGCCAGGATGACAGCACTGGTTTTGGTGGTGGTGGTGGTGGGTTTTTGGTTTTTTTCCCCCATTTTATCATTTGCCTGATTGGCTGACAGGATGCTGGGA

TGGAAGCCAAGGCCTCTGTGATGAGCTATAGGAGCATAGTCTGAAATTATCAATTCATGCCTCCTCCTCCTCTTCACTAACAAAACTTACTAAAATAAAA

CTGAAATCAGTACTTACTGC
Translation
MWTADEIAQLCYAHYNVRLPKQGKPEPNREWTLLAAVVKIQASANQACDIPEKEVQV - UNI24679 - VTKEVVSMGTGTKCIGQSKMRESG GDIL

NDSHAEIIARRSFQR RYLLHQLHLAAVLKEDSIFVPGTQRGLWRLRPDLSFVFFSSHTPC CGDASIIPMLEFEEQPCCPVIRSWANNSPVQETENLED

SKDKRNCEDPASPVAKKMRLGTPARSLSNCVAHHGTQESGPVKPDVSSSDLTKEEPDAANGIASGSFRVVDVYRTGAKCVPGETGDLREPGAAYHQVGLL

RVKPGRGDRTCSMSCSDKMARWNVLGCQGALLMHFLEKPIYLSAVVIGKCPYSQEAMRRALTGR - UNI3626 - - UNI35790 - RIIPEAAEQH

CR
Transcript ENSMUST00000070921
Sequence
GGGGCATCGCGTGGAGGTTGCGGCGCGTGGATAATAGGGTGTGAGGGACTCCGGATCGGCGTCTCGGG - UNI24679 - ATTTGGCTTTCTATAGTG

GCCTCAGCTCCAGCTCCACCTATGTGGACCGCGGATGAGATCGCTCAGCTGTGCTATGCACACTATAACGTCAGACTGCCCAAGCAGGGGAAGCCTGAGC

CAAATCGTGAGTGGACCTTGCTGGCAGCTGTGGTGAAGATTCAGGCTTCAGCTAACCAAGCTTGTGACATCCCTGAGAAGGAAGTGCAAG - UNI2467

9 - TGACAAAGGAAGTTGTCTCAATGGGAACAGGAACAAAATGCATAGGCCAGTCCAAGATGCGAGAGAGCG GGGACATCCTCAATGACAGCCATGCT

GAGATCATAGCCAGAAGGAGTTTCCAGAG ATACCTTCTCCATCAGCTCCATTTGGCAGCCGTCCTGAAAGAGGATAGCATCTTTGTTCCAGGGACCCAA

AGAGGACTGTGGAGGCTCAGACCTGACCTGTCGTTTGTGTTTTTCTCTAGCCACACACCCT GTGGGGATGCCTCCATCATCCCGATGCTCGAGTTTGAA

GAACAGCCTTGCTGTCCTGTCATCAGAAGTTGGGCCAACAACTCACCTGTACAAGAGACTGAGAATCTAGAGGATTCTAAAGATAAAAGGAACTGTGAAG

ATCCCGCCAGTCCTGTAGCCAAGAAGATGAGGCTGGGAACACCTGCCAGGTCACTCTCCAATTGTGTAGCTCACCATGGGACCCAGGAAAGTGGTCCAGT

CAAACCAGATGTCAGCAGCTCTGATCTCACCAAGGAGGAACCAGATGCTGCCAATGGAATAGCTTCAGGTAGCTTCAGAGTGGTGGATGTGTACAGGACG

GGAGCCAAGTGTGTTCCTGGAGAAACTGGAGACTTGAGAGAGCCAGGTGCTGCCTACCACCAGGTGGGGCTACTTCGTGTAAAACCTGGCAGGGGAGACA

GGACATGCTCCATGTCCTGCAGTGACAAGATGGCAAGGTGGAATGTCCTCGGATGCCAGGGCGCACTGCTGATGCACTTCCTGGAGAAGCCTATCTACCT

GTCAGCTGTGGTCATCGGGAAGTGCCCGTACAGCCAGGAAGCCATGAGGAGAGCATTGACTGGCAG - UNI3626 - - UNI35790 - ATCCCGAA

TCAGCAAGGTGGAACTCTTTAGATCATTCCAGAAGCTGCTGAGCAGCATTGCAGATGACGAGCAGCCAGACTCCATCAGGTGATATTGTCTGTCCCTCTG

TCCTCCTGTCTGTAAAGATTTCTCCTCTGGTTCTAGCTTATGTTTGGTGAGCTTATTAGGCTCAGTGAGCCAGTGGGTGCTTACTGCTTACCCAGAGAGA

ATGGGAAGTTGTCAGATTTGTGTCAGGGTCAGTTAGAGGAAAGGCTGTTCATGCAGGAAGGGGAAGGGGAAGGTTGGGTTTTCATCTTACACATTTATTT

ACTTGATTTGAGATAGGATCTCATTGCTCAGGTTGGCCTGAAACGAAAACTCACAGTTTACGCCAGCTTAAGCTCAAACCCAGAGCAGTTTGCCGGCTTC

CGCCTCCCACGTGCCAGGATGACAGCACTGGTTTTGGTGGTGGTGGTGGTGGGTTTTTGGTTTTTTTCCCCCATTTTATCATTTGCCTGATTGGCTGACA

GGATGCTGGGATGGAAGCCAAGGCCTCTGTGATGAGCTATAGGAGCATAGTCTGAAATTATCAATTCATGCCTCCTCCTCCTCTTCACTAACAAAACTTA

CTAAAATAAAACTGAAATCAGTACTTACTGC
Translation
 - UNI24679 - MWTADEIAQLCYAHYNVRLPKQGKPEPNREWTLLAAVVKIQASANQACDIPEKEVQV - UNI24679 - VTKEVVSMGTGTKCI

GQSKMRESG GDILNDSHAEIIARRSFQR RYLLHQLHLAAVLKEDSIFVPGTQRGLWRLRPDLSFVFFSSHTPC CGDASIIPMLEFEEQPCCPVIRSW

ANNSPVQETENLEDSKDKRNCEDPASPVAKKMRLGTPARSLSNCVAHHGTQESGPVKPDVSSSDLTKEEPDAANGIASGSFRVVDVYRTGAKCVPGETGD

LREPGAAYHQVGLLRVKPGRGDRTCSMSCSDKMARWNVLGCQGALLMHFLEKPIYLSAVVIGKCPYSQEAMRRALTGR - UNI3626 - - UNI3579

0 - RSRISKVELFRSFQKLLSSIADDEQPDSIR
Transcript ENSMUST00000034427
Sequence
GGGGCATCGCGTGGAGGTTGCGGCGCGTGGATAATAGGGTGTGAGGGACTCCGGATCGGCGTCTCGGG - UNI24679 - ATTTGGCTTTCTATAGTG

GCCTCAGCTCCAGCTCCACCTATGTGGACCGCGGATGAGATCGCTCAGCTGTGCTATGCACACTATAACGTCAGACTGCCCAAGCAGGGGAAGCCTGAGC

CAAATCGTGAGTGGACCTTGCTGGCAGCTGTGGTGAAGATTCAGGCTTCAGCTAACCAAGCTTGTGACATCCCTGAGAAGGAAGTGCAAG - UNI2467

9 - TGACAAAGGAAGTTGTCTCAATGGGAACAGGAACAAAATGCATAGGCCAGTCCAAGATGCGAGAGAGCG GGGACATCCTCAATGACAGCCATGCT

GAGATCATAGCCAGAAGGAGTTTCCAGAG ATACCTTCTCCATCAGCTCCATTTGGCAGCCGTCCTGAAAGAGGATAGCATCTTTGTTCCAGGGACCCAA

AGAGGACTGTGGAGGCTCAGACCTGACCTGTCGTTTGTGTTTTTCTCTAGCCACACACCCT GTGGGGATGCCTCCATCATCCCGATGCTCGAGTTTGAA

GAACAGCCTTGCTGTCCTGTCATCAGAAGTTGGGCCAACAACTCACCTGTACAAGAGACTGAGAATCTAGAGGATTCTAAAGATAAAAGGAACTGTGAAG

ATCCCGCCAGTCCTGTAGCCAAGAAGATGAGGCTGGGAACACCTGCCAGGTCACTCTCCAATTGTGTAGCTCACCATGGGACCCAGGAAAGTGGTCCAGT

CAAACCAGATGTCAGCAGCTCTGATCTCACCAAGGAGGAACCAGATGCTGCCAATGGAATAGCTTCAGGTAGCTTCAGAGTGGTGGATGTGTACAGGACG

GGAGCCAAGTGTGTTCCTGGAGAAACTGGAGACTTGAGAGAGCCAGGTGCTGCCTACCACCAGGTGGGGCTACTTCGTGTAAAACCTGGCAGGGGAGACA

GGACATGCTCCATGTCCTGCAGTGACAAGATGGCAAGGTGGAATGTCCTCGGATGCCAGGGCGCACTGCTGATGCACTTCCTGGAGAAGCCTATCTACCT

GTCAGCTGTGGTCATCGGGAAGTGCCCGTACAGCCAGGAAGCCATGAGGAGAGCATTGACTGGCAG GTGTGAGGAAACCTTGGTTTTACCCAGAGGCTT

TGGAGTTCAAGAACTGGAAATACAGCAGTCGGGTTTACTGTTTGAACAGAGCCGCTGTGCGGTGCACAGGAAAAGAGGTGACAGTCCAGGCCGACTCGTC

CCCTGTGGGGCAG - UNI3626 - - UNI35790 - CTATCAGCTGGAGCGCTGTCCCTCAGCAGCCCTTGGATGTTACAGCCAATGGTTTTCCACA

GGGAACAACAAAGAAAGAGATTGGAAGCCCTAGGGCCAG - UNI35790 - ATCCCGAATCAGCAAGGTGGAACTCTTTAGATCATTCCAGAAGCTGC

TGAGCAGCATTGCAGATGACGAGCAGCCAGACTCCATCAG - UNI21577 - - UNI35790 - GGTAACGAAGAAGCTGGACACCTATCAGGAGTA

CAAGGATGCTGCGTCCGCCTACCAGGAAGCCTGGGGTGCCCTCCGCAGGATACAGCCGTTTGCGTCCTGGATCAGAAACCCACCCGACTACCACCAATTT

AAATGA
Translation
 - UNI24679 - MWTADEIAQLCYAHYNVRLPKQGKPEPNREWTLLAAVVKIQASANQACDIPEKEVQV - UNI24679 - VTKEVVSMGTGTKCI

GQSKMRESG GDILNDSHAEIIARRSFQR RYLLHQLHLAAVLKEDSIFVPGTQRGLWRLRPDLSFVFFSSHTPC CGDASIIPMLEFEEQPCCPVIRSW

ANNSPVQETENLEDSKDKRNCEDPASPVAKKMRLGTPARSLSNCVAHHGTQESGPVKPDVSSSDLTKEEPDAANGIASGSFRVVDVYRTGAKCVPGETGD

LREPGAAYHQVGLLRVKPGRGDRTCSMSCSDKMARWNVLGCQGALLMHFLEKPIYLSAVVIGKCPYSQEAMRRALTGR RCEETLVLPRGFGVQELEIQQ

SGLLFEQSRCAVHRKRGDSPGRLVPCGAA - UNI3626 - - UNI35790 - AISWSAVPQQPLDVTANGFPQGTTKKEIGSPRAR - UNI35790

 - RSRISKVELFRSFQKLLSSIADDEQPDSIR - UNI21577 - - UNI35790 - RVTKKLDTYQEYKDAASAYQEAWGALRRIQPFASWIRNPP

DYHQFK

For any suggestions or comments, please send an email to unitrap@crg.es