Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031952 (Chst5)
Chromosomal location
Chr 8: 114413036 - 114434099 (-)
Description
carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 Gene [Source:MGI Symbol;Acc:MGI:1931825]
RefSeq_dna
NM_019950 
RefSeq_peptide
NP_064334.1 
UniGene
Mm.432506 
MGI
MGI:1931825 
Uniprot/SWISSPROT
Q9QUP4 
Human Ortholog
ENSG00000135702 (CHST5)
Omim 217800 - MACULAR DYSTROPHY, CORNEAL, 1  
UniTrap UNI14352
Vector Insertion
Chr 8: 114413035 - 114434100
Public Clones FHCRC-GT-S17-9H1 (fhcrc) IST12467D7 (tigm) IST13077D1 (tigm) IST14845C2 (tigm)
IST13061F3 (tigm) IST10245D3 (tigm) IST13200C3 (tigm) IST14569D10 (tigm)
IST14928G8 (tigm) IST14984F3 (tigm) IST12089C4 (tigm) IST14628E8 (tigm)
IST14785D8 (tigm) IST14948A6 (tigm) IST14319C10 (tigm) IST13604B1 (tigm)
IST11445B11 (tigm) IST13283C8 (tigm) IST14655B5 (tigm) IST10295E9 (tigm)
IST12706B12BBF1 (tigm) IST12694B9 (tigm) IST13030D3 (tigm) IST14818E2 (tigm)
IST12328A1 (tigm) IST14791A8 (tigm) IST12157E6 (tigm) IST14508E3 (tigm)
IST13417A8 (tigm) IST12784A5 (tigm) IST14790A5 (tigm) IST12617G5 (tigm)
IST11782E9 (tigm)
Private Clones OST311256 (lexicon) OST285488 (lexicon) OST104737 (lexicon) OST74806 (lexicon)
OST45601 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034430
Sequence
ACCACCGACTGAGCGGCTCTTTGTGTGCGCCCTGGGTGCGCAGCGCAGAAGCGCAGCGGGCAGCGCAG - UNI14352 - GCCCTAGCCAGAGGTATG

CGGCTACCCCGTTTCTCCAGCACTGTCATGCTTTCGCTCCTGATGGTACAGACTGGCATCCTGGTCTTCCTGGTCTCCCGGCAAGTGCCATCGTCCCCAG

CAGGCCTTGGGGAGCGTGTGCACGTGCTGGTACTGTCCTCGTGGCGCTCGGGCTCGTCCTTCGTGGGCCAGCTCTTCAGCCAACACCCCGATGTCTTCTA

CCTGATGGAGCCGGCTTGGCACGTCTGGGATACGTTGTCGCAGGGCAGTGCCCCCGCACTCCACATGGCCGTGCGTGACCTGATCCGCTCAGTGTTCCTA

TGCGACATGGACGTATTTGATGCCTACCTGCCCTGGCGCCGCAACATCTCGGATCTCTTCCAGTGGGCGGTGAGCCGCGCATTGTGCTCACCTCCGGTCT

GCGAAGCCTTCGCTCGTGGCAACATCAGCAGCGAGGAGGTGTGTAAGCCTCTGTGCGCAACGCGGCCCTTCGGCCTGGCTCAGGAAGCCTGCAGCTCCTA

TAGTCACGTCGTGCTCAAGGAGGTGCGCTTCTTTAACCTACAGGTGCTCTACCCGCTGCTCAGCGACCCTGCGCTCAACCTGCGCATCGTGCACCTAGTG

CGCGACCCGCGGGCCGTGCTGCGCTCCCGAGAGCAGACAGCCAAGGCGCTGGCACGGGACAATGGCATCGTCCTGGGTACCAACGGCACGTGGGTGGAGG

CGGACCCCCGGCTGCGCGTGGTCAACGAGGTATGCCGCAGCCATGTGCGCATCGCAGAGGCAGCCTTGCACAAGCCGCCGCCCTTCTTGCAAGATCGCTA

CCGCCTGGTGCGCTACGAGGATCTGGCCCGGGACCCACTCACCGTAATCCGTGAACTCTATGCCTTCACCGGCCTGGGTCTCACGCCGCAGCTCCAGACT

TGGATCCACAATATCACGCATGGTTCAGGGCCAGGCGCGCGCCGTGAAGCCTTCAAGACCACATCCAGGGATGCGCTCAGTGTATCCCAGGCCTGGCGCC

ACACGCTGCCCTTTGCCAAGATTCGCCGGGTCCAGGAACTGTGCGGGGGTGCACTGCAGCTGCTGGGTTACCGGTCTGTGCATTCGGAGCTTGAGCAAAG

GGACCTCTCTCTGGACCTCCTGCTGCCAAGAGGCATGGACAGTTTCAAGTGGGCATCGTCCACGGAGAAGCAACCGGAATCTTAGAATTTTAGTGGAGAG

ACCCAGCTATAACATTAGGGTCTATTGGAGTATGATAAAGAAAGGGCTTGGAGAACCCAAAAGCAAGTAGCTGGGAGTGTGAGTGATCTTGTCCTGTACT

AGGAAAGGATGGAGTCCAAATCCCACATCTCTTTCTGTCCAGATTGTAGTTTTCGGTTGGGTCTTTTAGGATTTGGATTCCCACCAAGTACTATCGAATG

GAAAGCAAAAGCTGTGCCCACTTCCTTCAGAGAGGCAGCCAGCCTCCTACTAAAGCACTTCCTTTCTCGTTGACTCTCTCCCCTCTTTGATCATACCATG

CAATCGCAGAGAATGGGGTCCCAGGCCTGCTCTGGAGTGCGGGAAAGGCGCGGCTGTGGGCTGGCTCCTAAAATCTGTGCACCTGCCTCTCGTTGGCTCA

CCCAGACCTCTGCTCACTGCCACGCCCTAGTATCTCAGTCCATCATAGACTTGGACAGTTATGGGCCTGGTCAAGGAGGAAAATGAGACGATGCTTCCCT

CTGTGATTCTCTGCCTGACCTTCTAGAAGGGAATCCAGGCACACACACAACCATACCTGAGGAGGATGGCTTTTTAATGAATCTTTGATTTGTCCTGAGA

TGAAAGATCCTAATTTATGGAAATAAACATAAATATGCTGCGTGATCC
Translation
 - UNI14352 - MRLPRFSSTVMLSLLMVQTGILVFLVSRQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDTLSQGSAP

ALHMAVRDLIRSVFLCDMDVFDAYLPWRRNISDLFQWAVSRALCSPPVCEAFARGNISSEEVCKPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYP

LLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVCRSHVRIAEAALHKPPPFLQDRYRLVRYEDLARDPLTVIRE

LYAFTGLGLTPQLQTWIHNITHGSGPGARREAFKTTSRDALSVSQAWRHTLPFAKIRRVQELCGGALQLLGYRSVHSELEQRDLSLDLLLPRGMDSFKWA

SSTEKQPES

For any suggestions or comments, please send an email to unitrap@crg.es