Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031954 (Cfdp1)
Chromosomal location
Chr 8: 114292373 - 114378210 (-)
Description
craniofacial development protein 1 Gene [Source:MGI Symbol;Acc:MGI:1344403]
RefSeq_dna
NM_011801 
RefSeq_peptide
NP_035931.1 
MGI
MGI:1344403 
Uniprot/SWISSPROT
O88271 
Human Ortholog
ENSG00000153774 (CFDP1)
Omim not available
UniTrap UNI6542
Vector Insertion
Chr 8: 114369112 - 114378043
Public Clones YHB054 (baygenomics) YHB052 (baygenomics) IST13047D7 (tigm)
Private Clones OST320506 (lexicon) OST89514 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8740
Vector Insertion
Chr 8: 114354890 - 114364257
Public Clones XF311 (baygenomics) XN377 (baygenomics) (ggtc) W191C01 (ggtc)
P099E07 (ggtc) M094A04 (ggtc) FHCRC-GT-S20-8E1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9019
Vector Insertion
Chr 8: 114303310 - 114354769
Public Clones (sanger) XF586 (baygenomics) Q021F06 (ggtc) P131H02 (ggtc) E047G09 (ggtc)
D184E04 (ggtc) D103G11 (ggtc) D010E01 (ggtc) P131F08 (ggtc) W245B07 (ggtc)
E326H10 (ggtc) E044F02 (ggtc) D142G04 (ggtc) D082B08 (ggtc) D007F09 (ggtc)
P028A09 (ggtc) E104B11 (ggtc) E031D08 (ggtc) D105A07 (ggtc) D019B07 (ggtc)
P006H08 (ggtc) E047F08 (ggtc) D103E07 (ggtc) D007H06 (ggtc) 5SE305A11 (ggtc)
M074A08 (ggtc) E036C04 (ggtc) D135G02 (ggtc) D076F07 (ggtc) P030H01 (ggtc)
E080C12 (ggtc) E027D08 (ggtc) W266E08 (ggtc) P099E07 (ggtc) E045D12 (ggtc)
D177E01 (ggtc) 3SE305A11 (ggtc) W195D07 (ggtc) D109E08 (ggtc) CMHD-GT_340H6-3 (cmhd)
CMHD-GT_540G2-3 (cmhd) CMHD-GT_504A7-3 (cmhd) CMHD-GT_268A4-3 (cmhd) CMHD-GT_517B11-5S (cmhd)
CMHD-GT_510C2-3 (cmhd) CMHD-GT_352E5-3 (cmhd) CMHD-GT_537D5-5S (cmhd) CMHD-GT_523D1-3 (cmhd)
CMHD-GT_268B10-3 (cmhd) CMHD-GT_534F4-3 (cmhd) CMHD-GT_495E4-3 (cmhd) CMHD-GT_298C4-3 (cmhd)
CMHD-GT_534F4-5S (cmhd) CMHD-GT_542E2-5S (cmhd) CMHD-GT_323G4-3 (cmhd) CMHD-GT_428B10-3 (cmhd)
CMHD-GT_505E4-3 (cmhd) CMHD-GT_504B2-3 (cmhd) CMHD-GT_268D3-3 (cmhd) CMHD-GT_540G2-5S (cmhd)
CMHD-GT_537E3-5S (cmhd) CMHD-GT_477G11-3 (cmhd) FHCRC-GT-S5-9A1 (fhcrc) FHCRC-GT-S23-5F1 (fhcrc)
FHCRC-GT-S13-3B1 (fhcrc) IST10138H5 (tigm) IST12272G7 (tigm) IST14674C5 (tigm)
IST12706E9 (tigm) IST13517G4 (tigm) IST10418H5 (tigm) IST13930C12 (tigm)
IST10574H10 (tigm) IST10824E6 (tigm) IST14345D8 (tigm) IST14538C6 (tigm)
IST11654B2 (tigm) IST12673C4 (tigm) IST12673B4 (tigm) IST13927H3 (tigm)
IST10536G4 (tigm) IST13964G11 (tigm) IST14886A9 (tigm) IST10466D5 (tigm)
IST13554C3 (tigm) IST10260D9 (tigm) IST12444C10 (tigm) IST10187F4 (tigm)
IST12067A6 (tigm) IST14817G9 (tigm) IST11156A1 (tigm) IST13517H5 (tigm)
IST10322A12 (tigm) IST13066F11 (tigm) IST10045H5 (tigm) IST10478E5 (tigm)
IST14890H8 (tigm) IST10827G7 (tigm) IST14350D9 (tigm) IST11217G1 (tigm)
IST12827G9 (tigm) IST13907C11 (tigm) IST14507F10 (tigm) IST12698H1 (tigm)
IST14418E5 (tigm) IST14700B1 (tigm) IST10171B8 (tigm) IST14709E3 (tigm)
IST11426E9 (tigm) IST14008G5 (tigm)
Private Clones OST500030 (lexicon) OST469261 (lexicon) OST469252 (lexicon) OST463743 (lexicon)
OST459970 (lexicon) OST459952 (lexicon) OST458833 (lexicon) OST457932 (lexicon)
OST457931 (lexicon) OST457930 (lexicon) OST456320 (lexicon) OST449980 (lexicon)
OST447464 (lexicon) OST442044 (lexicon) OST434792 (lexicon) OST432946 (lexicon)
OST432945 (lexicon) OST427431 (lexicon) OST426628 (lexicon) OST426626 (lexicon)
OST426585 (lexicon) OST416578 (lexicon) OST413943 (lexicon) OST410750 (lexicon)
OST397645 (lexicon) OST395063 (lexicon) OST393247 (lexicon) OST392952 (lexicon)
OST392525 (lexicon) OST390776 (lexicon) OST390273 (lexicon) OST385979 (lexicon)
OST381860 (lexicon) OST380395 (lexicon) OST374527 (lexicon) OST373854 (lexicon)
OST366669 (lexicon) OST366284 (lexicon) OST364459 (lexicon) OST361865 (lexicon)
OST361004 (lexicon) OST360217 (lexicon) OST359023 (lexicon) OST359019 (lexicon)
OST357496 (lexicon) OST351431 (lexicon) OST349595 (lexicon) OST349384 (lexicon)
OST344606 (lexicon) OST343644 (lexicon) OST330509 (lexicon) OST330196 (lexicon)
OST328573 (lexicon) OST322727 (lexicon) OST320768 (lexicon) OST318728 (lexicon)
OST318698 (lexicon) OST313918 (lexicon) OST313704 (lexicon) OST311569 (lexicon)
OST304225 (lexicon) OST302025 (lexicon) OST301515 (lexicon) OST301509 (lexicon)
OST298173 (lexicon) OST293434 (lexicon) OST292633 (lexicon) OST287526 (lexicon)
OST285592 (lexicon) OST282766 (lexicon) OST274390 (lexicon) OST274389 (lexicon)
OST274388 (lexicon) OST273891 (lexicon) OST273291 (lexicon) OST271278 (lexicon)
OST269624 (lexicon) OST262420 (lexicon) OST257563 (lexicon) OST237683 (lexicon)
OST210840 (lexicon) OST207373 (lexicon) OST202939 (lexicon) OST197633 (lexicon)
OST194203 (lexicon) OST191768 (lexicon) OST187333 (lexicon) OST169995 (lexicon)
OST165328 (lexicon) OST160865 (lexicon) OST158055 (lexicon) OST155143 (lexicon)
OST155047 (lexicon) OST148641 (lexicon) OST148537 (lexicon) OST140198 (lexicon)
OST138001 (lexicon) OST136417 (lexicon) OST133832 (lexicon) OST133119 (lexicon)
OST129191 (lexicon) OST129095 (lexicon) OST128944 (lexicon) OST126546 (lexicon)
OST123814 (lexicon) OST123794 (lexicon) OST115564 (lexicon) OST111689 (lexicon)
OST99684 (lexicon) OST97669 (lexicon) OST96125 (lexicon) OST80774 (lexicon)
OST77468 (lexicon) OST72730 (lexicon) OST71334 (lexicon) OST71226 (lexicon)
OST68823 (lexicon) OST68785 (lexicon) OST67673 (lexicon) OST67671 (lexicon)
OST67431 (lexicon) OST66227 (lexicon) OST64319 (lexicon) OST57634 (lexicon)
OST55569 (lexicon) OST50836 (lexicon) OST50411 (lexicon) OST45318 (lexicon)
OST44662 (lexicon) OST43290 (lexicon) OST43276 (lexicon) OST42037 (lexicon)
OST40181 (lexicon) OST38857 (lexicon) OST38854 (lexicon) OST37911 (lexicon)
OST37665 (lexicon) OST37493 (lexicon) OST36605 (lexicon) OST34386 (lexicon)
OST34045 (lexicon) OST33708 (lexicon) OST33077 (lexicon) OST33070 (lexicon)
OST32509 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10744
Vector Insertion
Chr 8: 114292688 - 114303150
Public Clones (sanger) E021C08 (ggtc) D086E03 (ggtc) D086G04 (ggtc) P062B02 (ggtc)
D086E04 (ggtc) CMHD-GT_139A4-3 (cmhd) CMHD-GT_415G1-3 (cmhd) CMHD-GT_544F3-5S (cmhd)
CMHD-GT_447H11-3 (cmhd) CMHD-GT_374H3-3 (cmhd) CMHD-GT_544F3-3 (cmhd) CMHD-GT_149D12-3 (cmhd)
CMHD-GT_491E10-3 (cmhd) CMHD-GT_108H2-3 (cmhd) CMHD-GT_396A6-3 (cmhd) CMHD-GT_541B7-5S (cmhd)
CMHD-GT_447E6-3 (cmhd) CMHD-GT_247F10-3 (cmhd) CMHD-GT_473E11-3 (cmhd) CMHD-GT_141.1E7-3 (cmhd)
CMHD-GT_413D4-3 (cmhd) CMHD-GT_236G6-3 (cmhd) CMHD-GT_379A11-3 (cmhd) CMHD-GT_541B7-3 (cmhd)
CMHD-GT_444A3-3 (cmhd) CMHD-GT_180D8-3 (cmhd) CMHD-GT_502F9-3 (cmhd) C24 (vanderbilt)
IST14298H4 (tigm) IST12920D3 (tigm) IST11061D5 (tigm) IST10521E7 (tigm)
IST12179E2 (tigm) IST10104G10 (tigm) IST14943G11 (tigm) IST12644F10 (tigm)
IST14788C2 (tigm) IST10504G12 (tigm) IST14747C6 (tigm) IST13754A9 (tigm)
IST11776B7 (tigm) IST12067A1 (tigm) IST12208B4 (tigm) IST14804D4 (tigm)
IST12893H7 (tigm) IST12201B6 (tigm) IST10922F5 (tigm) IST12652A12 (tigm)
IST13111F4 (tigm) IST13737C2 (tigm) IST12174D7 (tigm) IST12169C5 (tigm)
IST11834C7 (tigm) IST12534E5 (tigm) IST12620F2 (tigm) IST13481B8 (tigm)
IST10086F11 (tigm) IST10091H10 (tigm) IST12833C2 (tigm) IST12646B10 (tigm)
IST12643C12 (tigm)
Private Clones OST467354 (lexicon) OST460379 (lexicon) OST452700 (lexicon) OST438388 (lexicon)
OST437048 (lexicon) OST437040 (lexicon) OST436996 (lexicon) OST436968 (lexicon)
OST436965 (lexicon) OST436948 (lexicon) OST436944 (lexicon) OST434057 (lexicon)
OST432831 (lexicon) OST426391 (lexicon) OST379489 (lexicon) OST366827 (lexicon)
OST362552 (lexicon) OST361171 (lexicon) OST356205 (lexicon) OST355121 (lexicon)
OST354193 (lexicon) OST352114 (lexicon) OST346322 (lexicon) OST337000 (lexicon)
OST336981 (lexicon) OST333497 (lexicon) OST325638 (lexicon) OST325636 (lexicon)
OST325634 (lexicon) OST325456 (lexicon) OST323800 (lexicon) OST311123 (lexicon)
OST277363 (lexicon) OST277347 (lexicon) OST241705 (lexicon) OST239638 (lexicon)
OST212738 (lexicon) OST212735 (lexicon) OST197603 (lexicon) OST196385 (lexicon)
OST182331 (lexicon) OST182021 (lexicon) OST180921 (lexicon) OST161418 (lexicon)
OST160722 (lexicon) OST148167 (lexicon) OST110275 (lexicon) OST103946 (lexicon)
OST87503 (lexicon) OST82092 (lexicon) OST70897 (lexicon) OST68505 (lexicon)
OST68492 (lexicon) OST66182 (lexicon) OST56017 (lexicon) OST56013 (lexicon)
OST56009 (lexicon) OST52470 (lexicon) OST45435 (lexicon) OST41326 (lexicon)
OST41212 (lexicon) OST36675 (lexicon) OST36644 (lexicon) OST36167 (lexicon)
OST35319 (lexicon) OST29493 (lexicon) OST29444 (lexicon) OST28983 (lexicon)
OST28846 (lexicon) OST28721 (lexicon) OST26606 (lexicon) OST26471 (lexicon)
OST24564 (lexicon) OST23128 (lexicon) OST22082 (lexicon) OST22008 (lexicon)
OST20950 (lexicon) OST20853 (lexicon) OST19856 (lexicon) OST18413 (lexicon)
OST18038 (lexicon) OST17925 (lexicon) OST15986 (lexicon) OST15913 (lexicon)
OST15306 (lexicon) OST14713 (lexicon) OST13850 (lexicon) OST13559 (lexicon)
OST13462 (lexicon) OST13344 (lexicon) OST12662 (lexicon) OST9304 (lexicon)
OST8398 (lexicon) OST8157 (lexicon) OST8059 (lexicon) OST6976 (lexicon)
OST5558 (lexicon) OST3177 (lexicon) OST2930 (lexicon) OST1392 (lexicon)
OST282 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034432
Sequence
AGCTGCTGGTCCTGTACCCCTATGGTCTCGCCCTATATCTAGCTTCGCTATTTTGGGGCAGTGGCCGCAGTCGTGTGGGTAGCAGGCCCCAAGTGACAGC

AGCATGGAGGAATTCGACTCCGAAGACTTCTCCACATCGGACGAGGATGAGGACTACTTGCCGTCCG - UNI6542 - GTGGAGAGTACAGTGAAGAT

GATGTCAATGAATTAGTAAAGGAAGATGAAGTGGACGGTGAAGAGCAGGCTGAGAAAACCAAAGGGAAAAGAAGGAAGGCTCAGGGCATTCCAGCCAG G

AAAAGGAAACAAAGTGGCCTCTTGTTAGAAGAAGAGGAAGATGGCAAGGAAGACTCTGGAGGTAGTAGCAGTGAAGAAGATGAAGAGGAGCAAGAAGGAG

GCCTTGGGTCAGAGAATGCAAGGAAGAAGAAGGAAGATGAGTTGTGGGCCAGCTTCCTTAATGATGTAGGACCAAAGTCAAAAGCAGCCCCAGGTTCACA

AACTAAG GTAGCCGAGGAGACTGAAGAGATTAGTTCGAATAAACCGTTGGTCAAAGCAGATGAGCTGGATAAGCCTAGAGAATCAGAAAAGGTGAAGAT

TACCAAGGTGTTTGACTTCGCTGGCGAAGAAGTAAG - UNI8740 - GGTGACTAAGGAAGTAGATGCTGCGTCTAAGGAAGCGAAGTCTTTCCTCAA

GCAAACAGAGAGAGAAAAACCGCAGGCTCTTGTCACTTCACCAGCGACACCACTCCCTGCTGGGTCAGG - UNI9019 - GATAAAAAGAGCAAGTGG

TATGAGCAGCCTCTTAGGGAAAATTGGAGCCAAAAAACAGAAGATGAGCACCCTTGAGAAATCCAAACTGGACTGGGAGAGCTTCAAGGAAGAAGAGGGG

ATTGGTGAAGAACTGGCCATCCATAACCGAGGGAAAGAAGG - UNI10744 - GTACATTGAGCGGAAAGCTTTTCTGGATCGAGTGGACCACAGGCA

GTTTGAAATTGAGCGAGATCTCAGGCTGAGCAAAATGAAACCTTGACATTCTGGGAAGGATTCCTAGCAGCTGAATCCTATTGACAATGTGAGCTCCTCT

GAGTGTCTGTGAAATACTTCCAGTGTTCCTCATCATGTTTCCAGCAAGTCCCTTTTTCTACGTTGCAGTTTGTTTAATGTATGTTAATTTCACCTGGCTT

CATTCATTTTCCTTTTTAAAATTTGTCTTTTAAATAAACAAACAGAACCCTCTGTGAGGTTGGTGAGAGT
Translation
MEEFDSEDFSTSDEDEDYLPSG - UNI6542 - GGEYSEDDVNELVKEDEVDGEEQAEKTKGKRRKAQGIPAR RKRKQSGLLLEEEEDGKEDSGGSS

SEEDEEEQEGGLGSENARKKKEDELWASFLNDVGPKSKAAPGSQTK VAEETEEISSNKPLVKADELDKPRESEKVKITKVFDFAGEEVR - UNI8740

 - RVTKEVDAASKEAKSFLKQTEREKPQALVTSPATPLPAGSG - UNI9019 - GIKRASGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGE

ELAIHNRGKEG - UNI10744 - GYIERKAFLDRVDHRQFEIERDLRLSKMKP

For any suggestions or comments, please send an email to unitrap@crg.es