Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031967 (Afg3l1)
Chromosomal location
Chr 8: 126001788 - 126026076 (+)
Description
AFG3(ATPase family gene 3)-like 1 (yeast) Gene [Source:MGI (curated);Acc:Afg3l1-001]
RefSeq_dna
NM_054070 
RefSeq_peptide
NP_473411.2 
UniGene
Mm.287475 
MGI
MGI:1928277 
Uniprot/SWISSPROT
Q920A7 
Human Ortholog
not available
Omim not available
UniTrap UNI16973
Vector Insertion
Chr 8: 126001948 - 126004248
Public Clones IST11645E8 (tigm)
Private Clones OST451460 (lexicon) OST444155 (lexicon) OST296472 (lexicon) OST63815 (lexicon)
OST41360 (lexicon) OST41359 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19280
Vector Insertion
Chr 8: 126004337 - 126004970
Public Clones not available
Private Clones OST397049 (lexicon) OST182479 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6898
Vector Insertion
Chr 8: 126005046 - 126008502
Public Clones BGB088 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27361
Vector Insertion
Chr 8: 126012226 - 126013654
Public Clones not available
Private Clones OST61694 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28302
Vector Insertion
Chr 8: 126018832 - 126022487
Public Clones not available
Private Clones OST34562 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001520
Sequence
GGCGCGAGGTCAGGGCCGGGGGATGTTACTGCGGCTGGTGGGGGCGGCGGGCAGTCGAGCCCTGGCCTGGCCTTTCTCCAAGCTGTGGCGATGTGGCGGA

TGCGCAGGGAGCGGCGGGACGGTCTGGAGCAGCGTGAGGGCCTGTGGCATTGCTCTGCAG - UNI16973 - GGTCATCTGGGGAGATGCTCGCAGCA

GCTGGCTCTGCAGGGAAAACTGACTTCATTTTCCCCGAGGCTGTATTCAAAACCTCCCAGAG - UNI19280 - GGTTTGAGAAGTTTTTTAAGAATA

AGAAGAACAGAAAAAGTGCAAGCCCAGGAAATTCAGTACCTCCAAAAAAAG - UNI6898 - AACCAAAAAATGCTGGCCCTGGAGGAGATGGAGGCA

ACAGAGGAGGGAAAGGAGATGATTTTCCCTGGTGGAAACGGATGCAAAAG GGAGAATTTCCTTGGGACGACAAGGACTTCCGGAGCCTGGCTGTTTTGG

GGGCTGGTGTGGCTGCGGGATTTTTATATTTTTATTTCCGAGATCCCGGAAAAGAGATCACCTGGAAACACTTCGTGCAGTATTACCTGGCCAGAGGTCT

G GTGGACCGGCTAGAGGTTGTGAACAAGCAGTTTGTGCGTGTTATTCCTGTTCCTGGGACGACATCTGAG AGGTTCGTGTGGTTTAACATTGGCAGTG

TTGACACCTTTGAACGGAACCTCGAGTCTGCTCAGTGGGAGCTGGGCATTGAGCCCACCAACCAGGCTGCGGTGGTCTACACTACTGAGAGTGATGG - 

UNI27361 - CTCTTTTCTTAGAAGTCTTGTGCCCACTCTGGTCCTGGTTAGCATCCTCCTATATGCTATGAGGAGGGGTCCAATGGGGACTGGTCGCG

GTGGGCGAGGAGGAGGCCTCTTCAGTGTTGGTGAGACAACAGCCAAGATCTTAAAGAACAACATCGATGTGCGGTTTGCAGATGTGGCTGGCTGTGAAGA

AGCCAAACTGGAAATTATGGAGTTTGTGAATTTCCTGAAGAACCCAAAGCAATATCAGGACTTAGGAGCCAAAATTCCAAAG GGAGCGATGCTCACTGG

TCCACCTGGTACTGGCAAAACACTTCTTGCAAAAGCAACTGCTGGGGAGGCCAACGTGCCCTTCATCACCGTGAATGGGTCGGAATTCCTGGAAATGTTT

GTTGGTGTTGGGCCAGCACGG GTCCGTGACATGTTTGCAATGGCCCGAAAACACGCTCCTTGTATTTTATTCATTGATGAGATTGATGCAATTGGCAGA

AAGCGAGGCCGTGGCCACCTGGGAGGCCAGAGTGAGCAGGAAAACACTTTAAACCAGATGCTTGTGGAGATGGACG GGTTCAACTCTTCCACTAATGTG

GTAGTGTTAGCCGGCACCAATCGCCCTGATATCCTTGACCCAGCCCTGACACGGCCTGGCCGGTTTGACCGTCAGATCTACATCG GTCCCCCTGATATC

AAAGGCAGGTCCTCTATTTTCAAGGTCCACTTGCGTCCACTCAAGCTGGACGGAAGCCTCAGCAAGGACGCTCTTTCGAGGAAGCTGGCAGCTCTTACTC

CAGGCTTCACTG - UNI28302 - GTGCTGATATTTCCAATGTTTGCAATGAAGCAGCACTGATTGCTGCCCGCCACCTCAGCCCTTCTGTCCAGGAG

CGGCACTTTGAGCAAGCCATCGAGAGGGTCATTGGAG GCCTTGAGAAGAAGACCCAGGTCCTACAACCCAGTGAAAAGACAACTGTAGCCTACCACGAG

GCTGGGCATGCAGTGGTGGGCTGGTTCTTGGAGCATGCAGACCCTCTGCTGAAG GTGTCCATCATACCTCGAGGCAAGGGGCTTGGCTACGCCCAGTAC

CTTCCCCGCGAGCAGTTCCTCTACACACGAGAGCAGCTCTTCGACCGCATGTGTATGATGCTGGGGGGTAGGGTAGCTGAGCAGCTGTTCTTTGGTCAGA

TCACCACCGGAGCTCAGGACGACCTGAGGAAGGTCACCCAGAGTGCCTATGCCCAG ATTGTGCAGTTTGGGATGAGTGAGAAGCTGGGCCAGGTGTCCT

TTGACTTCCCCAGACAAGGCGAAACCATGGTGGAGAAGCCATACAGTGAGGCTACTGCCCAGCTCATTGATGAAGAGGTCCGGTGCCTCGTCAGGTCTGC

CTATAATCGGACCCTGGAGCTGCTCACACAGTGCCGGGAGCAGGTGGAGAAG GTTGGCAGGCGTCTCCTGGAGAAAGAAGTGCTGGAGAAAGCCGACAT

GATAGAGCTCTTGGGCCCTCGGCCCTTTGCAGAGAAGTCCACCTATGAGGAATTTGTAGAGGGCACCGGCAGCCTAGAGGAGGACACATCCCTTCCTGAG

GGGCTGAAAGACTGGAATAAGGGGCGGGAGGAAGGAGGCACTGAGCGGGGCTTGCAGGAGAGCCCTGTGTAGCCTGTGGCCACCGGGGCGGCTTATGACC

ACTGCTGACTGGGAGCTGCTCAGCCATCGCAGAGCAGCTGTCAGAGTAACTGAAAGACTAATTAAAACAGGTGACAACTTCG
Translation
MLLRLVGAAGSRALAWPFSKLWRCGGCAGSGGTVWSSVRACGIALQ - UNI16973 - GHLGRCSQQLALQGKLTSFSPRLYSKPPRG - UNI1928

0 - GFEKFFKNKKNRKSASPGNSVPPKKE - UNI6898 - EPKNAGPGGDGGNRGGKGDDFPWWKRMQK GEFPWDDKDFRSLAVLGAGVAAGFLYF

YFRDPGKEITWKHFVQYYLARGL VDRLEVVNKQFVRVIPVPGTTSE RFVWFNIGSVDTFERNLESAQWELGIEPTNQAAVVYTTESDG - UNI2736

1 - GSFLRSLVPTLVLVSILLYAMRRGPMGTGRGGRGGGLFSVGETTAKILKNNIDVRFADVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPK GAML

TGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPAR VRDMFAMARKHAPCILFIDEIDAIGRKRGRGHLGGQSEQENTLNQMLVEMDG GFNS

STNVVVLAGTNRPDILDPALTRPGRFDRQIYIG GPPDIKGRSSIFKVHLRPLKLDGSLSKDALSRKLAALTPGFTG - UNI28302 - GADISNVCN

EAALIAARHLSPSVQERHFEQAIERVIGG GLEKKTQVLQPSEKTTVAYHEAGHAVVGWFLEHADPLLK VSIIPRGKGLGYAQYLPREQFLYTREQLFD

RMCMMLGGRVAEQLFFGQITTGAQDDLRKVTQSAYAQ IVQFGMSEKLGQVSFDFPRQGETMVEKPYSEATAQLIDEEVRCLVRSAYNRTLELLTQCREQ

VEK VGRRLLEKEVLEKADMIELLGPRPFAEKSTYEEFVEGTGSLEEDTSLPEGLKDWNKGREEGGTERGLQESPV
Transcript ENSMUST00000098320
Sequence
GGCGCGAGGTCAGGGCCGGGGGATGTTACTGCGGCTGGTGGGGGCGGCGGGCAGTCGAGCCCTGGCCTGGCCTTTCTCCAAGCTGTGGCGATGTGGCGGA

TGCGCAGGGAGCGGCGGGACGGTCTGGAGCAGCGTGAGGGCCTGTGGCATTGCTCTGCAG - UNI16973 - GGTCATCTGGGGAGATGCTCGCAGCA

GCTGGCTCTGCAGGGAAAACTGACTTCATTTTCCCCGAGGCTGTATTCAAAACCTCCCAGAG - UNI19280 - GGTTTGAGAAGTTTTTTAAGAATA

AGAAGAACAGAAAAAGTGCAAGCCCAGGAAATTCAGTACCTCCAAAAAAAG - UNI6898 - AACCAAAAAATGCTGGCCCTGGAGGAGATGGAGGCA

ACAGAGGAGGGAAAGGAGATGATTTTCCCTGGTGGAAACGGATGCAAAAG GGAGAATTTCCTTGGGACGACAAGGACTTCCGGAGCCTGGCTGTTTTGG

GGGCTGGTGTGGCTGCGGGATTTTTATATTTTTATTTCCGAGATCCCGGAAAAGAGATCACCTGGAAACACTTCGTGCAGTATTACCTGGCCAGAGGTCT

G GTGGACCGGCTAGAGGTTGTGAACAAGCAGTTTGTGCGTGTTATTCCTGTTCCTGGGACGACATCTGAG AGGTTCGTGTGGTTTAACATTGGCAGTG

TTGACACCTTTGAACGGAACCTCGAGTCTGCTCAGTGGGAGCTGGGCATTGAGCCCACCAACCAGGCTGCGGTGGTCTACACTACTGAGAGTGATGG - 

UNI27361 - CTCTTTTCTTAGAAGTCTTGTGCCCACTCTGGTCCTGGTTAGCATCCTCCTATATGCTATGAGGAGGGGTCCAATGGGGACTGGTCGCG

GTGGGCGAGGAGGAGGCCTCTTCAGTGTTGGTGAGACAACAGCCAAGATCTTAAAGAACAACATCGATGTGCGGTTTGCAGATGTGGCTGGCTGTGAAGA

AGCCAAACTGGAAATTATGGAGTTTGTGAATTTCCTGAAGAACCCAAAGCAATATCAGGACTTAGGAGCCAAAATTCCAAAG GGAGCGATGCTCACTGG

TCCACCTGGTACTGGCAAAACACTTCTTGCAAAAGCAACTGCTGGGGAGGCCAACGTGCCCTTCATCACCGTGAATGGGTCGGAATTCCTGGAAATGTTT

GTTGGTGTTGGGCCAGCACGG GTCCGTGACATGTTTGCAATGGCCCGAAAACACGCTCCTTGTATTTTATTCATTGATGAGATTGATGCAATTGGCAGA

AAGCGAGGCCGTGGCCACCTGGGAGGCCAGAGTGAGCAGGAAAACACTTTAAACCAGATGCTTGTGGAGATGGACG GGTTCAACTCTTCCACTAATGTG

GTAGTGTTAGCCGGCACCAATCGCCCTGATATCCTTGACCCAGCCCTGACACGGCCTGGCCGGTTTGACCGTCAGATCTACATCG GTCCCCCTGATATC

AAAGGCAGGTCCTCTATTTTCAAGGTCCACTTGCGTCCACTCAAGCTGGACGGAAGCCTCAGCAAGGACGCTCTTTCGAGGAAGCTGGCAGCTCTTACTC

CAGGCTTCACTG - UNI28302 - GTGCTGATATTTCCAATGTTTGCAATGAAGCAGCACTGATTGCTGCCCGCCACCTCAGCCCTTCTGTCCAGGAG

CGGCACTTTGAGCAAGCCATCGAGAGGGTCATTGGAG GTGTCCATCATACCTCGAGGCAAGGGGCTTGGCTACGCCCAGTACCTTCCCCGCGAGCAGTT

CCTCTACACACGAGAGCAGCTCTTCGACCGCATGTGTATGATGCTGGGGGGTAGGGTAGCTGAGCAGCTGTTCTTTGGTCAGATCACCACCGGAGCTCAG

GACGACCTGAGGAAGGTCACCCAGAGTGCCTATGCCCAG ATTGTGCAGTTTGGGATGAGTGAGAAGCTGGGCCAGGTGTCCTTTGACTTCCCCAGACAA

GGCGAAACCATGGTGGAGAAGCCATACAGTGAGGCTACTGCCCAGCTCATTGATGAAGAGGTCCGGTGCCTCGTCAGGTCTGCCTATAATCGGACCCTGG

AGCTGCTCACACAGTGCCGGGAGCAGGTGGAGAAG GTTGGCAGGCGTCTCCTGGAGAAAGAAGTGCTGGAGAAAGCCGACATGATAGAGCTCTTGGGCC

CTCGGCCCTTTGCAGAGAAGTCCACCTATGAGGAATTTGTAGAGGGCACCGGCAGCCTAGAGGAGGACACATCCCTTCCTGAGGGGCTGAAAGACTGGAA

TAAGGGGCGGGAGGAAGGAGGCACTGAGCGGGGCTTGCAGGAGAGCCCTGTGTAGCCTGTGGCCACCGGGGCGGCTTATGACCACTGCTGACTGGGAGCT

GCTCAGCCATCGCAGAGCAGCTGTCAGAGTAACTGAAAGACTAATTAAAACAGGTGACAACTTCG
Translation
MLLRLVGAAGSRALAWPFSKLWRCGGCAGSGGTVWSSVRACGIALQ - UNI16973 - GHLGRCSQQLALQGKLTSFSPRLYSKPPRG - UNI1928

0 - GFEKFFKNKKNRKSASPGNSVPPKKE - UNI6898 - EPKNAGPGGDGGNRGGKGDDFPWWKRMQK GEFPWDDKDFRSLAVLGAGVAAGFLYF

YFRDPGKEITWKHFVQYYLARGL VDRLEVVNKQFVRVIPVPGTTSE RFVWFNIGSVDTFERNLESAQWELGIEPTNQAAVVYTTESDG - UNI2736

1 - GSFLRSLVPTLVLVSILLYAMRRGPMGTGRGGRGGGLFSVGETTAKILKNNIDVRFADVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPK GAML

TGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPAR VRDMFAMARKHAPCILFIDEIDAIGRKRGRGHLGGQSEQENTLNQMLVEMDG GFNS

STNVVVLAGTNRPDILDPALTRPGRFDRQIYIG GPPDIKGRSSIFKVHLRPLKLDGSLSKDALSRKLAALTPGFTG - UNI28302 - GADISNVCN

EAALIAARHLSPSVQERHFEQAIERVIGG GVHHTSRQGAWLRPVPSPRAVPLHTRAALRPHVYDAGG  
Transcript ENSMUST00000098319
Sequence
CAAGGGGCTTGGCTACGC CAGTACCTTCCCCGCGAGCAGTTCCTCTACACACGAGAGCAGCTCTTCGACCGCATGTGTATGATGCTGGGGGGTAGGGTA

GCTGAGCAGCTGTTCTTTGGTCAGATCACCACCGGAGCTCAGGACGACCTGAGGAAGGTCACCCAGAGTGCCTATGCCCAG ATTGTGCAGTTTGGGATG

AGTGAGAAGCTGGGCCAGGTGTCCTTTGACTTCCCCAGACAAGGCGAAACCATGGTGGAGAAGCCATACAGTGAGGCTACTGCCCAGCTCATTGATGAAG

AGGTCCGGTGCCTCGTCAGGTCTGCCTATAATCGGACCCTGGAGCTGCTCACACAGTGCCGGGAGCAGGTGGAGAAG GTTGGCAGGCGTCTCCTGGAGA

AAGAAGTGCTGGAGAAAGCCGACATGATAGAGCTCTTGGGCCCTCGGCCCTTTGCAGAGAAGTCCACCTATGAGGAATTTGTAGAGGGCACCGGCAGCCT

AGAGGAGGACACATCCCTTCCTGAGGGGCTGAAAGACTGGAATAAGGGGCGGGAGGAAGGAGGCACTGAGCGGGGCTTGCAGGAGAGCCCTGTGTAG
Translation
QGAWLR QYLPREQFLYTREQLFDRMCMMLGGRVAEQLFFGQITTGAQDDLRKVTQSAYAQ IVQFGMSEKLGQVSFDFPRQGETMVEKPYSEATAQLID

EEVRCLVRSAYNRTLELLTQCREQVEK VGRRLLEKEVLEKADMIELLGPRPFAEKSTYEEFVEGTGSLEEDTSLPEGLKDWNKGREEGGTERGLQESPV


For any suggestions or comments, please send an email to unitrap@crg.es