Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031976 (AK122209)
Chromosomal location
Chr 8: 126545408 - 126572404 (+)
Description
URB2 ribosome biogenesis 2 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:2681124]
RefSeq_dna
NM_001029876 
RefSeq_peptide
NP_001025047.1 
UniGene
Mm.334891 
MGI
MGI:2681124 
Uniprot/SPTREMBL
Q80U74 
Human Ortholog
ENSG00000135763 (KIAA0133)
Omim not available
UniTrap UNI12015
Vector Insertion
Chr 8: 126545708 - 126547359
Public Clones M053C01 (ggtc) (ggtc) P008F09 (ggtc) PST8058-NR (escells) IST14892G3 (tigm)
Private Clones OST299582 (lexicon) OST217805 (lexicon) OST210293 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1170
Vector Insertion
Chr 8: 126547499 - 126548955
Public Clones AY0135 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36723
Vector Insertion
Chr 8: 126549133 - 126551758
Public Clones IST11260A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8312
Vector Insertion
Chr 8: 126555090 - 126558927
Public Clones RRF370 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034457
Sequence
GCCGCCGTGGAGGTCCCAGGTGAGCGGACGGTTGGAGAGTTTGGGTTTCCTCTGCGCCGAGGCGCCAGTTTGGCGGATGCGGACACCAGTCCTAACAGGA

GGGAACCGGCTGGAGAGCCGGGATCGGAGGAGCCTCTGCCCGAGGGAGTTCCCGCTATGGAACCCTGCTTGAGGTTCTGAACTGCTTTACCCCGAACTGA

AGGAGCTCCACTTGAGAGAACCTTGATCTGAGGGAGACCCACGTTAGAGAGCACCCCGATCTCCTACACGGAGCTCGGACTCGAGGGAGCCCCGATCCAG

 - UNI12015 - AAGACGTGTAGCAATGGCTGCTGTTTATTCTGGTATTTCCTTTAAACTTAAAAGCAAGACAACTTCCTGGGAAGATAAACTAAAAT

TAGCTCACTTTGCTTGGATTTCCCATCAGTGCTTTCTACCAAATAAAGAACAA - UNI1170 - GTTTTACTTGATTGGGCAAGGCAGTCATTGGTTG

CATTTTATAAGAAAAAGCTTGAACTGCAGGAAGATATTGTTGAAAGGCTCTGGATCTATGTAGATAACATTCTACATAGTAAGAAATTGCAGAACCTCCT

TAAGGATGGGAAGACTGTAAATCTCCAGCTCTCCCTTGTCAAG - UNI36723 - ATCATAAATGAGAGAATAGAAGAGTTCTCACGTTCAGGATGCC

AGAGGAATATCTGTGCCGTCCTGAGTTGCTGCCAGGGCATCCTCTCAGCACCTGCCCTTGCTGTCATCTATACAGCCAAACCAGAGCTCATTGTGGCTTT

GCTGAGCCAGCTCTGCTGGTCGGCCTGCAGACAGCCAGAAGGAGCCACGACAGCCAAGCTGTTTGAGGTCATTCATCTGGCTCTTGACCATTACCTCAGA

CTTCAGCAACAACAAGCCAACCCTAAGCGTGTCTTTGGAGATATGACTGGACACCTCTTTCAGCCCTGCCTAGTCCTGAGACACTTGCTTTTGGGGGGCA

CGTGGACCCAAGCTAGTCAGGGTCAGCTATGGCAGGTACTGAGCAGAGATATCAGGAGCAAGATTGACGCTGTTCTTCGAGCTGGTGTTTTTCGACACGA

TTTACTTTCATCCTACAAAGAGGAGCTCTTGGAGCAGCACCAAGAGAGTGTGAGGATGGGGGTCCTGAAGGGTCTTCTCACTCCAATGGAAGCTGTGATT

GCAAGACTGGTAGAGCCTGGCTATGTCAGATCAGACCTCCATGCTTTGGTTGTGGCCAGCTCAGTGCCCTTGTTGTTTAGACTCTTTCTGGAAGCATACC

TTCAGGAAGAAAGCCAGTTTCTCTGTTTTCAGGTTCTCCCCAGGTTGTTTGGCTGCTTGCAGATTTCACACCTGCAGGAGGGGCAGATAGAAGCCCTGTC

CCTATCAGATTGGACTACAGAGCTTCTGGCTATAGAGCAACTGTTAAACTCAGTGGCCACCAGTAACATCTACAATGTGGCTACTGACAGGATTCGGCAT

GCAGAGACACAGTTTCACTTCTACCGCCGTGTGGCTGAGGTGCTGATCAACCATTCACAAGCATCTGTGCCAGCTTGGTTTCGCTGCCTCAAGATTTTGA

TCTCTCTGAATCATTTGATTTTAGAGCCAGACCTGGATGACCTGTTGTCTTCGGCTTGGATTGATGCGGAAGTAACAGAATTTCGAGCCAAAAAGGCCCA

GGAGGTACTTATCAACACTGTCTTCCAGACGTACGCCAAACTCCGACAGGTGCCACGGTTGTTTGAGGAGGTTTTGGGGGTGATCTGCCGCCCAGCTGCT

GAGGCACTGCGGCAGCCTTTGCTTGCCTCAGGCCTCTCTGTGGCTCTCAGTGCATGTCTTTTGGAGCTGCCACTGAGTCAGATCCTGGATTCATGGTCCC

TTGTGCTAGATAAGTTCCAGTCTTTAGTTATGCCCTGTTTGCAGAGTGATACTGACATGGCTTTAAAGGCAATGTCACTGAGCTCTCTGCTGCACTGCAT

CATGTTCAACATGCAGAGTCTGGACAATAACATGCCTCTGCCCATCATAAGACGGACACAGTGCATAATGGAGAGGATGCTGAGAGAGCTTGTGGGGCCC

CTTTTGGGCCTTCTCCTGGACCTCTGGAGTCCAGAGCCTGAGCTGTGGCAGCAGAAGGTGTGTGACTCTGCACTCTTACTCTCTTACACCTGGGCTCAGG

TGGACGCTACCATCAGTTTGCACTGCAGCCAGTATTATTCTCTGGGGATCTCCCTAGCCAGAGCTGCTCTGGATAGTTCAAACCTCCCTTTGTTGCTACC

AGGTGTAGAAATGGAGTTTTGGAAGAAGGTGGAAGAGTGTGTAGGCCAGTCCAGGTCTCTCAGTAGGTACTGCTTAGAACAGCTGTATCTTCAGAAGGTG

AAAAGGACTTTAATGCGGAGTAATTCACAATCCAAAGAAGCCCTTCAAACCTTGAGGTTTGACACTGCTCACATTCTTGATTCTAGCAGAGACTGTTTAA

GTCAGAAGACAGCAGCTGCCTGGGATAGGCAGGTGTCGACAATGAATGAGTCCATATATCCTGTAGCACACTGGCACTTGATTGTATCAAACCTCACAGT

TTTAATACCCTACCTTTGTTTGAATGATGTGAGATATGTGGCCACTGTCTTGTTAAGAACTTTACCAGCAAGTAAAGCCCAGGGAAGCTTGGCACATGGT

GAGCCACATGTCACACTTGAGAAAATATCCACAGCCCTCCTTCACAGCCCTCTCTTTCCAGAGATGCAGTCCCTCTACTCTGCCTTCCTGACGTGTATCA

TTGCAGAATGTTCCAGCACTCTGTGCTCTGGAGCTCATAGTGACCTGAGTCTTGTTAGTCAGCAGCTCCCCTGGCTTTCTGGAAAGGACGACCACACAAT

CGTGGCTCACTGGGAAACCAGATTGGCAAAAGTTGGACCTGAAGGTGTAGAACCAAGAGGAGAAATTGCCCAGAATTTTCTATCCATGGTCAAGAGTGGT

TTTCCAATCAAGCTGGATGAAGAACAGCTAAAAGGCCTCCTGGAGCTCTTAGAAGTCATCTCTGCCCTTCGCCTGGACAGCCTCTCGCCATCTTACCACG

TGCATATGTTTTTCCTGCTATTCTCCATGGCTGTCTCCACATTAGGGCATTGCTCTTGCCCACTAGCCCTCCAGTTCTTGGTGAAGTGCTACCGGCTCCT

CAGTAGTCTGCAGAGAGGAAAGAATGGCCGCACTGTATTCAGGGTTATGTACGTTAGTGACATCTTTGAGGTTGTGCTGACCTCACTGTTGCAAGCCAGT

GCCGAGTTTCAGGTTAGGGAGGATGACCCTGCTTGGCTGCAGCTTCTTCAGGTGTCAGGGGTGTTCTTAGAGCAGCTGATGCAGATGCTTACCCAAGTCA

AGCTGAGCTTGGTGCTCAACTTCGGGAAAATCACTGCCTTTCTCTCAAGGTACAGGAAGGAAGCTTCCTGCAAAGAGGGGAAAATCCCGAACCTTCGGAG

CAGGCAACTGCTTCTGGTGGCTCTAACCAAGTTGTGTCAGAGTTTGGGGCCTTGTGTTAAGGAGCGGAGGCAGCTACTGGAGGCCCCAGCAGAGCTAGCT

GAATTGCTACAGCAGGCCATGATGCAGATGGGCACCATGCTGAAGCTTTGCCTAGTGTCCGGGACTACAGGCCGCCGCCGCCTGCCTTCAGTACTCCTCG

CTGCTGTCCCCACACTTTTAGAAGTAGACATGAGCCAGCACCTCAGGGACGGACAGCCCAAAATTGCTCAAGTGGTGGATACAGACAAAACACTGCTTTC

TCATGGGACACTTTACCAGGATGTCTACACGCAGTTGCTGGAGGAGTTGCCAGCCCTGTCGGGGAATGCTCAGTCTTTCCAGGCAGCATTGCAATTTCTA

ACCTTGTTCCTTTTGGCCCCAGAGCTCCATTCCAAGGAGACCTCTGTTTTTGCTTCCGTCTTTTATTCTGTGCAGAAAGTTCTTACAG - UNI8312 -

 GTCCATGCATACCTGCTCCAGTCACTCAGGATACTGAACTTCACTTGGGAGCCCTGCTCACCCAGATGTTTGAGGCTGGGACAACAGAGCACTTTGGGA

TGGTACTGCAGTCTATTCTTCAGGGGCTGGACGTCACTCAGGCATGGAGGTCAGATCTACAG GTTGTTTTGTGTGCCATTAGACTACTCAAACTGCTAC

TCAAATGTCCACTCAACGGAGAAAAGGCAAGTTTGCTGTGGCGTTCGTGTCCCCAGATCATCACGGCTCTAATG CTGCAACACCGAGAGGCCTGCCGGG

AGCAGCCTGTGGCCCTAGCAGTGATTGAGCCTGTTCTTGAAGTTCTGGCCGTTCTGCTCCGGAAAGGGGAGGAGAGCATTAGCAACCCTCACCATGTCAG

CCTGGCCTTCAACATCCTGCTCACAGTCCCTCTGGAGCACCTGCAGCCTCGGGAGTTTGGCAGCGTCTTCCTGAAGATGCACAGTGTGCTCTTCTCCATC

TTGCAGTGCCACTCCAAG GTGATGCTGAAGGCCGTTCCATCTTTCTTGAACTCCTTCAATAGACTGTTGGTTTCAGTTATGCATGAAGGACGGCAGAAA

GACAAAG GGAGTGTGGATGACCTGACAGTGGTCCTTGAGTCTGCACGCCTGGTGGAGAGGATGTATAGCCACCTTGCTACTCGAGCTGAGGAGTTCACC

GCGTTCTCCCCGTTCCTGGTGGCCCAGTATGTGACAGAGGTCCAGAAG GTAACCTTGTACCCACCTGTGAAGAACCTGCTTCAGGAGGGGATTTATCTC

ATCTTGGATCTTTGCATGGAGCGGGATATCCAGTTTCTTCGGGCCTCACTACAGGCTGGAGCGCGAGATGTCTTTAAGGATCTGCACAGCGACTACCTCA

AGTACCACAAGGCCAAGCATGAAGGAGAGAAAAGATATACGGCCTAGGTCACACCACAGAATCACCTGGGACACCTTGCAGAACATTCATAGTTCAGAGT

CCTGGAGGATGTAAGGCTTCTGACGTTCTCATACACGTTGTCAACAACCATGGAAAACACACACACACACACACACACACACACACACACACACAGTCTC

ACTGTATATCCTTGAATGGCCTAGAACTCACTATGTAGAACACCAGGCTGGCTTTGAACTCACAGAGATCCCTCTGCTTTCTGTATGCCGAGTCTAAATG

TATCACCTTGCCCACCTTGGGGATTATATATTTTTATAGCTTTTTTTTTTAAATGCTAAATGTTCTTTGATATCCCACCCCTCCAGCAGGATAAAGATTG

AACCAGGCCCTCACACACACTAATTGCACACTTCTGCGGCTCAGCCACACCTGCATGCCTCAGTGCACCTTTGAAAACTAAGTGTGGTATAAGAGACCTG

GAAATCGGGACTGGGCTTGGTGGTGCACATCTTTAATCCCAGCATTCAGGAGGCAGAGGGAGGTGGATCTCTGTGAGTTTGAGGCCAGCAAAGCCACACA

CAGAAACCTTGTATCGAAAACAAACAAACAAATAAACTTGGAAATGGGTTCTGAGATGAATTTAATGGAAAATTCCTGACCATTATGACTGTACCTAATG

TGGTCCTTTCTTTCCTCTCTTCTGGCTGTGAACTGCGTAGAATTGGGTCTATAATTGAATCCTGTGTGAGTAATTCTGCTCTTTAAGTTAAATCAAGTTG

CACAGAGACACTTTCCAGCTGCTACACTGTGCCGTCCTGTTGGGAATTCTAGTGGTGCTGGGGAACAGCCAGGGCCCAGCAGGGTGGTGTGCACTTGTCT

GGTAGGGAAGTCCTCTAGCACAGGAGACAGGACTCCTGCTTGTTCCCACTTCAGTTTGAGAAGCTGATTACAAATCTTTTCCTACTCAGTTCAAAAATAA

CGTTAACAGTTCTTACGACCTAAGCAATATATCATAGTGGTCTTGATTATTAAGCCTTTATTATCGCTTGGAAATGTCTTGTTTTAGAGTCTTTGCTGTA

TATATATAGATACATATGTGCATATATATATATATATATATAGTAAATTGATCAAAAATGTGTTTTAAGGTTTCTTAATGTTTTCTTTTGTAATGGCTGT

CATTATCTTAAGAGTTAATAAAAAAATTTGGTATTTTTTAATGTC
Translation
 - UNI12015 - MAAVYSGISFKLKSKTTSWEDKLKLAHFAWISHQCFLPNKEQ - UNI1170 - VLLDWARQSLVAFYKKKLELQEDIVERLWIY

VDNILHSKKLQNLLKDGKTVNLQLSLVK - UNI36723 - IINERIEEFSRSGCQRNICAVLSCCQGILSAPALAVIYTAKPELIVALLSQLCWSACR

QPEGATTAKLFEVIHLALDHYLRLQQQQANPKRVFGDMTGHLFQPCLVLRHLLLGGTWTQASQGQLWQVLSRDIRSKIDAVLRAGVFRHDLLSSYKEELL

EQHQESVRMGVLKGLLTPMEAVIARLVEPGYVRSDLHALVVASSVPLLFRLFLEAYLQEESQFLCFQVLPRLFGCLQISHLQEGQIEALSLSDWTTELLA

IEQLLNSVATSNIYNVATDRIRHAETQFHFYRRVAEVLINHSQASVPAWFRCLKILISLNHLILEPDLDDLLSSAWIDAEVTEFRAKKAQEVLINTVFQT

YAKLRQVPRLFEEVLGVICRPAAEALRQPLLASGLSVALSACLLELPLSQILDSWSLVLDKFQSLVMPCLQSDTDMALKAMSLSSLLHCIMFNMQSLDNN

MPLPIIRRTQCIMERMLRELVGPLLGLLLDLWSPEPELWQQKVCDSALLLSYTWAQVDATISLHCSQYYSLGISLARAALDSSNLPLLLPGVEMEFWKKV

EECVGQSRSLSRYCLEQLYLQKVKRTLMRSNSQSKEALQTLRFDTAHILDSSRDCLSQKTAAAWDRQVSTMNESIYPVAHWHLIVSNLTVLIPYLCLNDV

RYVATVLLRTLPASKAQGSLAHGEPHVTLEKISTALLHSPLFPEMQSLYSAFLTCIIAECSSTLCSGAHSDLSLVSQQLPWLSGKDDHTIVAHWETRLAK

VGPEGVEPRGEIAQNFLSMVKSGFPIKLDEEQLKGLLELLEVISALRLDSLSPSYHVHMFFLLFSMAVSTLGHCSCPLALQFLVKCYRLLSSLQRGKNGR

TVFRVMYVSDIFEVVLTSLLQASAEFQVREDDPAWLQLLQVSGVFLEQLMQMLTQVKLSLVLNFGKITAFLSRYRKEASCKEGKIPNLRSRQLLLVALTK

LCQSLGPCVKERRQLLEAPAELAELLQQAMMQMGTMLKLCLVSGTTGRRRLPSVLLAAVPTLLEVDMSQHLRDGQPKIAQVVDTDKTLLSHGTLYQDVYT

QLLEELPALSGNAQSFQAALQFLTLFLLAPELHSKETSVFASVFYSVQKVLTG - UNI8312 - GPCIPAPVTQDTELHLGALLTQMFEAGTTEHFGM

VLQSILQGLDVTQAWRSDLQ VVLCAIRLLKLLLKCPLNGEKASLLWRSCPQIITALM LQHREACREQPVALAVIEPVLEVLAVLLRKGEESISNPHHV

SLAFNILLTVPLEHLQPREFGSVFLKMHSVLFSILQCHSK VMLKAVPSFLNSFNRLLVSVMHEGRQKDKG GSVDDLTVVLESARLVERMYSHLATRAE

EFTAFSPFLVAQYVTEVQK VTLYPPVKNLLQEGIYLILDLCMERDIQFLRASLQAGARDVFKDLHSDYLKYHKAKHEGEKRYTA

For any suggestions or comments, please send an email to unitrap@crg.es