Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031977 (Galnt2)
Chromosomal location
Chr 8: 126755294 - 126869618 (+)
Description
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 Gene [Source:MGI Symbol;Acc:MGI:894694]
RefSeq_dna
NM_139272 
RefSeq_peptide
NP_644678.2 
UniGene
Mm.33808 Mm.406657 Mm.408088 
MGI
MGI:894694 
Uniprot/SWISSPROT
Q6PB93 
Uniprot/SPTREMBL
Q3UA32 Q3UM52 
Human Ortholog
ENSG00000143641 (GALNT2)
Omim not available
UniTrap UNI29991
Vector Insertion
Chr 8: 126755550 - 126819257
Public Clones D163C05 (ggtc) IST12218A8HMR1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11805
Vector Insertion
Chr 8: 126862470 - 126864718
Public Clones W181A02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034458
Sequence
CGGGCGCCGAGCGCCGAGCGCCGAGCGCCGCCCGCCGAGCGCCGCGTCTTCCCGCGCCGCCGCCCCGAGCTCCGCCCGCCGCGCGCTCCGCCCGCCGCGC

CGCCAGGCTGCCCGGCGGCCGCCCAGAGCGAGGATGCGGCGGCGCTCGCGGATGCTGCTGTGCTTCGCGCTGCTCTGGGTCCTGGGCATCGCCTACTACA

TGTACTCGGGGGGCGGCTCCGCGCTGGCCGCGGGCGGGGGCGGCGCCGGCAGGAAG - UNI29991 - GGTGACTGGAATGACATCGACTCCATTAAG

AAGAAAGACCTTCACCACAGCAGAGGAGATGAGAAAGCACAGGGTGTGGAGACCCTCCCTCCAG GCAAAGTCCGGTGGCCAGACTTTAACCAGGAGGCA

TACGTTGGCGGTACAATGGTTCGCTCTGGGCAGGACCCGTACGCACGCAACAAGTTCAACCAGGTGGAGAGTGACAAGCTGCACATGGACAGAGGCATCC

CCGACACCCGGCATGACCA GTGTCAGCGCAAGCAGTGGCGAGTGGACCTGCCAGCCACCAGCGTGGTGATCACATTCCACAATGAAGCCAGGTCGGCCC

TGCTGCGGACGGTGGTCAG TGTCCTCAAGAGGAGTCCACCTCACCTCATCAAGGAGATAATCCTGGTGGATGACTACAGCAACGACC CTGAGGACGGG

GCCCTCTTGGGGAAAATCGAGAAGGTGCGGGTCCTCAGAAATGACCGGAGAGAAG GTCTAATGCGCTCTCGGGTCCGGGGTGCCGACGCCGCCCAGGCC

AAGGTCCTGACCTTCCTAGACAGTCACTGCGAGTGTAACGAGCGATGGCTGGAGCCACTCTTGGAGCGGGTTGCTGAG GACAGGACCCGAGTTGTATCC

CCCATTATCGATGTCATTAACATGGATAATTTCCAGTATGTGGGCGCCTCTGCTGACCTCAAGGGTG GTTTTGACTGGAACTTGGTGTTCAAGTGGGAT

TACATGACACCAGAGCAGAGGCGATCCCGGCAGGGGAACCCAGTTGCCCCTATAAA AACTCCGATGATCGCTGGCGGCCTCTTCGTGATGGACAAGCTC

TATTTTGAAGAGCTGGGGAAGTACGACATGATGATGGACGTGTGGGGAGGAGAGAACTTGG AGATCTCATTCCGAGTGTGGCAGTGTGGTGGCAGCCTG

GAGATCATCCCGTGCAGCCGCGTGGGCCACGTGTTCCGGAAGCAGCATCCCTACACGTTCCCCGGTGGCAGCGGCACTGTCTTTGCCCG GAACACACGC

CGGGCAGCTGAAGTCTGGATGGATGAGTACAAACATTTCTACTACGCAGCGGTGCCTTCTGCACGAAACGTGCCCTATGGGAA TATTCAGAGCAGGCTG

GAGCTCAGGAAAAAGCTGGGCTGCAAGCCCTTCAAGTGGTACCTGGACAACGTCTACCCGGAGCTGAG GGTTCCAGACCACCAGGACATAGCTTTCGGG

GCCTTACAGCAGGGAACCAACTGCCTGGACACCTTGGGACACTTCGCGGATGGAGTTGTTGGAATTTATGAGTGTCACAACGCTGGAGGAAACCAG - U

NI11805 - GAATGGGCCTTGACAAAGGAGAAGTCGGTGAAGCACATGGACCTGTGCCTTACTGTGGTGGACCGTTCGCCTGGGTCACTCATCAGGCTG

CAGGGCTGCCGGGAGAACGACAGCAGACAG AAGTGGGAGCAGATCGAAGGCAACTCCAAACTGCGACACGTGGGCAGCAACCTGTGCCTGGATAGCCGC

ACTGCCAAGAGCGGAGGCCTGAGTGTGGAGGTGTGTGGCCCGGCCCTGTCACAACAGTGGAAGTTCTCACTCAACCTGCAGCAATAAGAGGCCCCCGGGG

CCCAACGTCCACCCGCACACCGGCCCAGTTTGTTGATCACGTAATTACGTTTCTGAAACTTTCCGCAAAACTATATACCTCAGTGTTCCATCACGGTCTG

ACAGTCTTAAGTCTCAAGTCTTCATCGAGGCATGAGCGGGGCAGACAGCAGTGCAGAAGAGGAAAGGAGCCCCTGGGGCTCAGGACAGAGGGTCCCTCCC

AAGGCTGGCGCCCTCTGCCTCCCTCTTTCTGCTTCCTGCTCACACCCCAGCACTGGCCGGAACAAGTGGGCAAGCAGCAATCATGTTTATATCTCAGACA

GAGGAAGCAGGGGCAGGCGCCCCCACAGTGAGAGCTCGCCAATCTCCACTCTGTTTTACCTATTCAAAATCGTGTGTGTGTGTGTGAACCAGGCATGGTG

GCCAGTGCCTGTAATCCCATCACTCAGGAGGCTGAGGCAGGCAAGGCCCTGTCTAAGGAAAAAAAAAAAAATGATTTCCACAAAGCTGGCCTTTCCTTGT

CTGTCCCTGCACCCGGGCTCAGCTGGCCTCCCAGCCACGTCCCCTCTTCCATTGACATACTTGCTGTATTTGAACGTGAACTTTCCTCTGGTGGACACTA

AATAGAGATAAAGAGAATCATGGTCCGTTCCCTACGCTTCCCCGACATCATCTTGTGAACCCTGCAACGCAGCGCAGCCCAGAGCAAAGGTGCATCTCTG

GGGCCTCACCAGCCGGCCCACGCTGCTCCTCCAGTAGGGGCATCCCCAAACCACTGGCCCCACCCACAAGCGTCAATGTTTAACTTCAGCGAGGGGATCG

CAGCTGGGTTAGAAAGTCTGCTTTGTGCCCATTGTCATCTGTAAAACTAAATAGGTCACCTCTTTTGGCAAGTATTGCTTTGGGTTTTCTTTTAAAATTA

GATTTCTTTTCTTTAGGAAAACTCAACCCCACAGCTTCTAACTAATGTGAGCCAGCAGGACCCTACTGCCTTGTGACAGACCAGGGACACTGGACAGCTG

TCACCCACTATCCCTAGGCTCACAGTGGTTTGAGACCCTGTATGTTGGGTCTTTGGTACTAAGCTGCCGGCAGAGCACAGAAGAGCAGCTCTTCAGCCTG

TGGGTGGACCCCACGTGCCCGTAGCCCTGGTGTGGGTAATACCCCCGGTACATCCACAGGCAACTGCAGGAATTATGGGTAGAGTTCAGATCACAAGGCC

TGCGCACTCCCACTGAGGACCTAGGCATGTGTTAGCCACAGAGGTGACCTGGATGTGGGGAAGTGACACCTGGTGGGCTGCAGGCATCATACGTGCTCAT

CTCGGGTATCCCAGAGATCTCGGGAATCAGAGTTCCAGGTGGTCAGAGGGCCTGTAGGTGAGTGCTGTGCCTCCCGCCTGCTCCAGAAGGGGGGTAGCTG

GTTTCTTCTACCTGAGGGGCTCCATGTGTGTACTCACCATGTGTGTATTCGCCATGACCATGGACCCTCTGCGAAGGCCTGGCCAGGTGCTGACCCTCTG

TCTTTCTACCCCTGCCAAGCAACCAACAGAAGAGACATTGTAACAGACAGGGTGCCCACATGTCTAATTAAGTTCATACAATGTCCACCTTCCAATGTAG

GCTCTGGGAACTGTCACTCCCAGGTACAGGTGCAAAGCTGTCAAGGACAAGGCAGGAGTTTGCTGGAGTCCGGTCACCACGACCTTTGCTAACCCTGACA

CTCCTGCACTGCTTCTATCAGAGTGACTCCACAGATGTGAGACAACATGGGGCGTCCCAACCACACGTGTACCCCACCCCACCCTGTGGCCTCTTAACCT

TTGTACCATCTGATTGTCTGGCCACCAGGGTGCCAACTCAACCCAGCTCCGAGCAGAGGGGGGTGTGGGCAGGGCCCGTCGGTGAGCCATGTTTACATGA

CAGTGTGCCAAAGTGACTCGCCGAGCTTGTATTGCTTTGTAGTCATCTGGGCTATCCCACCCTCCCAACTCCTGTTTTTAAAACTAAAAACTCCCAGGAG

CCCTGGGCGCACACAGGCAAAGGTGGCTGTCTTCTGTGGTGGTCCTTGAGTCTCCGTGAAGCTGAAAATGATGGTGTCTGTGAGTATGTTTTGCAAATTC

AAAATATAGTTTGGTAATTTTTTTTCCAGTTGATTTTTAAAAAAACAAAACAAAAAACTGCTGTACAGAGCTTGTACTTTGTCCATTTTATAGATGGAAA

CCATCCTTGAAATTGTTTAACTTAAATAAAGAGAAGATACTTTATAG
Translation
MRRRSRMLLCFALLWVLGIAYYMYSGGGSALAAGGGGAGRK - UNI29991 - GDWNDIDSIKKKDLHHSRGDEKAQGVETLPPG GKVRWPDFNQEA

YVGGTMVRSGQDPYARNKFNQVESDKLHMDRGIPDTRHDQ QCQRKQWRVDLPATSVVITFHNEARSALLRTVVS SVLKRSPPHLIKEIILVDDYSNDP

 PEDGALLGKIEKVRVLRNDRREG GLMRSRVRGADAAQAKVLTFLDSHCECNERWLEPLLERVAE DRTRVVSPIIDVINMDNFQYVGASADLKGG GF

DWNLVFKWDYMTPEQRRSRQGNPVAPIK KTPMIAGGLFVMDKLYFEELGKYDMMMDVWGGENLE EISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFP

GGSGTVFAR RNTRRAAEVWMDEYKHFYYAAVPSARNVPYGN NIQSRLELRKKLGCKPFKWYLDNVYPELR RVPDHQDIAFGALQQGTNCLDTLGHFA

DGVVGIYECHNAGGNQ - UNI11805 - EWALTKEKSVKHMDLCLTVVDRSPGSLIRLQGCRENDSRQ KWEQIEGNSKLRHVGSNLCLDSRTAKSGG

LSVEVCGPALSQQWKFSLNLQQ

For any suggestions or comments, please send an email to unitrap@crg.es