Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031981 (Capn9)
Chromosomal location
Chr 8: 127100021 - 127142625 (+)
Description
calpain 9 Gene [Source:MGI (curated);Acc:Capn9-001]
RefSeq_dna
NM_023709 
RefSeq_peptide
NP_076198.1 
UniGene
Mm.6209 
MGI
MGI:1920897 
Uniprot/SWISSPROT
Q9D805 
Uniprot/SPTREMBL
Q6PDE6 
Human Ortholog
ENSG00000135773 (CAPN9)
Omim not available
UniTrap UNI28826
Vector Insertion
Chr 8: 127141392 - 127142381
Public Clones not available
Private Clones OST18724 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093033
Sequence
CCTCTAAGCTGCGGGGAAGCTGTCATGCCTTACCTGCATCGGTCCCTGAGGCCACAGCCACAGCCAGTCCCCGGGGATGCCAGGACTATCCACTCCTCAG

GTCAGAGCTTTGAGCAGCTGAGGCAGGGCTGCCTGCAGTCTGGCACCTTGTTTGAGGATGCTGACTTCCCTGCCAGCAATGTCTCCCTGTTCTACAGCGA

GAGGCCCCAGGTCCCCTTTGTGTGGAAACGGCCAGGG GAAATTGTGGAAAAACCAGAATTCATTCTTGGAGGGGCCACCAGGACCGACATTTGCCAAGG

GGAGCTGG GAGACTGCTGGCTCCTGGCGGCCATTGCCTCCCTAACCCTCAATCAGAAAGCACTGACCAGGGTGGTTCCCCAGGACCAAGGATTTGGTTC

TGGCTATGCCGGGATATTTCATTTCCAG TTCTGGCAGCACAGTGAGTGGCTGGACGTAGTGATTGATGACCGCCTGCCCACCTTCAAGGACCGCCTGGT

CTTCCTCCACTCTGCTGATCACAATGAGTTCTGGAGCGCACTGCTGGAGAAAGCCTATGCCAA GCTTAACGGGAGTTATGAGGCACTGAAGGGAGGCAG

TGCCATTGAAGCCATGGAAGACTTCACTGGGGGTGTGGCTGAGAACTTCCAAATCCGAGAGGCACCAGAGGATTTCTTTGAGATTCTGGAGAAGGCTTTG

AAGCGTGGTTCCTTGCTGGGATGCTCCATAGAT ACCCTGAATGCCTCAGAATCTGAAGCTCGAACATCTCTTGGTCTCATTAAGGGCCATGCCTACACC

GTGACGGGGCTCGATCAG GTAAACTTCCATGGCCAGAGAATCAAGCTCATCAGAGTCCGTAACCCTTGGGGCCAGGTGGAGTGGAACGGGCCATGGAGT

GACAG CTCTCCTGAGTGGCGCTCTGTGGACCTGGAGGAGCAGAAGCGCCTGGGCCACACTGCCCTTGATGACGGGGAGTTCTG GATGGCATTCAAAGA

CTTCAAGATCCATTTTGACAAAGTGGAGATCTGCAACCTCACACCTGATGCCCTGGAGGACAGCGCCCTCCACAGGTGGGAGGTGACCATCCACCAAGGA

AGCTGGGTCCGTGGCTCCACTGCTGGTGGCTGTCGCAACTTCCTGG ACACCTTCTGGACCAACCCTCAGATAAAGCTGTCCCTGACCGAGAGGGACGAG

GGCCAGGAGGGCTGCACTTTCCTAGCAGCCTTGATGCAGAAAGACCGCAGGAGGCTCAAGAGGTTTGGCGCCAACATGCTGACCATTGGCTACGCCATTT

ACCAG TGCCCAGACAAGGACGGACACCTGAGTAGGGACTTTTTCAGGTACCATGCCTCCCTGGCCCGAAGCAAGACGTTCATCAACTTGAGAGAAGTCT

CAGAGCGATTCCAGCTGCCCCCGGGAGACTATATCCTCATCCCCAGCACCTTTGAGCCGCATCAGGAGGCCGACTTCTGCCTGAGAATCTTCTCTGAGAA

GAGAGCTGTGACTCG GGACCTGGACGAGAACATAGACATTGACCTTCCTGAG CTTCCAAAGCCGACTCCACAGGAGGAGGAAACAGAAGAGGAACAGC

AGTTCCGGGCCCTGTTCCAGCGAGTTGCTGGCGAG GACATGGAGGTGTCAGCTGAGGAGCTTGAATATGTTCTAAATGCTGTTCTGCAGAAGA AAACA

GCCCTCAAGTTCAAGAGGCTGAGCCTGCTGTCCTGCAGAAACATCATCTCTCTGATGGAT ACCAGTGGCAACGGGAAGCTGGAGTTTGAAGAGTTCCGG

GTCTTCTGGGACAAGCTGAAACACTGGATG GACCTGTTTCTCCAGTTCGATGTGGACAAGTCTGGCACCATGTCTTCCTATGAGCTGCGGACGGCACTG

AAAGCTGCAG GCTTTCAGCTGGGTGGCCATCTCCTGCAGCTGATTGTCCTCAGGTATGCAGATGAGGACCTCCAGCTGGATTTCGATGACTACCTCAAC

TGCCTGGTGCGGCTGGAGAATGCAAGCC GGGTGTTCCAATCTCTCAGTGTGAAGAACAAGGACTTCATCCATCTCAACATAAACGAG - UNI28826 

- TTCATCAGCCTGACCATGAACATCTGAGGTTGCTCTGACCCGATGCCGTCTGCCCCTCTGATACTCAGCTTCTGGATCATGAACCTCGAAACTTTTTT

TTAGAGGGCTGCCCCGCCCACTGCTCTCTCTCCTCCCGGCCTCACACCACCCTCCTCCCCTCTCCATAGTGAGTTAGAAGAATCTAAAGGGATTGGCTGA

GTTCTCTGATTCTGTGGAACTTCTTATAAAATCATTGCTCTACAAG
Translation
MPYLHRSLRPQPQPVPGDARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSERPQVPFVWKRPG EIVEKPEFILGGATRTDICQGELG GDC

WLLAAIASLTLNQKALTRVVPQDQGFGSGYAGIFHFQ FWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAK KLNGSYEALKGGSAIE

AMEDFTGGVAENFQIREAPEDFFEILEKALKRGSLLGCSID TLNASESEARTSLGLIKGHAYTVTGLDQ VNFHGQRIKLIRVRNPWGQVEWNGPWSDS

 SSPEWRSVDLEEQKRLGHTALDDGEFW WMAFKDFKIHFDKVEICNLTPDALEDSALHRWEVTIHQGSWVRGSTAGGCRNFLD DTFWTNPQIKLSLTE

RDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQ CPDKDGHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRI

FSEKRAVTR RDLDENIDIDLPE LPKPTPQEEETEEEQQFRALFQRVAGE DMEVSAEELEYVLNAVLQKK KTALKFKRLSLLSCRNIISLMD TSGN

GKLEFEEFRVFWDKLKHWM DLFLQFDVDKSGTMSSYELRTALKAAG GFQLGGHLLQLIVLRYADEDLQLDFDDYLNCLVRLENASR RVFQSLSVKNK

DFIHLNINE - UNI28826 - FISLTMNI

For any suggestions or comments, please send an email to unitrap@crg.es