Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031983 (2310022B05Rik)
Chromosomal location
Chr 8: 127159666 - 127187269 (-)
Description
RIKEN cDNA 2310022B05 gene Gene [Source:MGI Symbol;Acc:MGI:1916801]
RefSeq_dna
NM_175149 
RefSeq_peptide
NP_780358.2 
UniGene
Mm.261920 
MGI
MGI:1916801 
Uniprot/SWISSPROT
Q8C3W1 
Human Ortholog
ENSG00000119280 (C1orf198)
Omim not available
UniTrap UNI4377
Vector Insertion
Chr 8: 127175322 - 127186747
Public Clones AE0888 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034464
Sequence
GGCGTAGGCGGCCCGTACGAAGGGTGTCCCGGGAAGGTCTGGGGGCGGTGCTCAGCCAGGGGCGGAGGAGGAGGGCTCAGCGGGTGGGGTAGGGACGGCG

CTCCGGGAGGAGACGGAGGCGGAGCCCCGGGGCGGGGCGCGGGCGGACCGGGAGGCGGCGCTCCGACCGGGACGCGCGGGCCGGGTATGGCGTCGATGGC

GGCGGCGATCGCGGCCTCGCGTTCGGCCGTCATGAGCGGGAACCGGCCGCTGGACGACCGGGAGCGGAAGCGCTTCACCTACTTCTCATCGCTGAGCCCC

ATGGCCAGGAAGATCATGCAGGACAAGGAGAAGATCCGGGAGAAGTACGGGCCCGAGTGGGCGCGGCTGCCGCCCGCGCAGCAGGACGAAATCATCGACC

GCTGCCTGGTGGGGCCTCGCGCCCCGGCGGCCGCCGCCGATGCGGGGGACGTGCGGGACCCGGCGCGCTTCCCTGGCCTGCGCGGGCCCACGGGCCAGAA

GCTGGTGCGCTTCGGCGACGAG - UNI4377 - GACATAACTTGGCAAGATGAACACTCGGCCCCATTCTCCTGGGAGACGAGG AGTCAGATGGAAT

TCAGCATCTCCTCCTTATCCATCCAGGAGCCCAGCGCTGCCACTGTGACCAGTGATGCCAGGTCCCTGGCCAAGGCTCCTCAGGGCACACAGGGTTCCAA

ACCTGCCCAGAGCAGCAGATCCTCTAGCCTGGATGCCCTGGGACCGGCTCGGAAAGAGGAAGAAGCACCCTTCTGGAAGATCAATGCCGAGCGCTCTCGG

GAGGGGCCTGAGGCTGAGTTCCAGTCCCTGACACCCAGCCAGATCAAGTCCATGGAGAAGGGGGAAAAGGTTCTGCCAGCTTGCTACCGCCAAGAGCCCA

CCACGAAAGACAGGGAGGCCAAACCTGTGCCACAGGAACAGCAGACCCTCCCCAGTGTGAGCGCAGAGCAAGAGGTGCCCCAGCCGGTGCAAGCCCCTGC

CAGCTTGCTGCCCAAGGCTACCCCCACGGAGTCCCCAGAGAAGCCACCGCCTCCTGCCGTCCAGCGGGACGAAGATGATGATGCTCTGTTCTCAGAGCCT

GCACTTGCGCAG ATCAGCTCCAGTAATGTGCTCTTGAAGACAGGCTTTGATTTTCTGGACAACTGGTAAATGGTGCTACCCAGAAACACAGCCAGGAGC

CCCGCGTGGCCCACCGTGGTGTTCAGAGGAGAAGGCAGCACTGCCTGCGTCTTTTCCTGTTTTCTCTACTCCTTTCTTAGTCTTTTTGGAAACTAGGAAA

TGTTGCCAGGTTTTCCCCGTTTTTGGTAAAACCAAATAGATAAATATGCTATTTTCAATGATTTGATAACAAGTTTTACACTTGGGATTTTTAAACACTA

GGTACCCAGTAAGCCTTGTAAATAAAACTTCTGTTCCCAGCTCCATCCCACCTTCCCTCCAATGAGGTTCCCTGACCAAGTCACAAAAGGTCGCAAAAGT

GACTCTTTCTTGTCACTTCCTGTTGAGGGCTCCCTGGGTAGATATGAGCTGTTGGCTGTCACTGTGGAAGACTCATCCTTAAAAAGTGTGCTCACCTGGT

ACCCTTTCTTCATAGAAGCCAGGTTAAGCACTACGTATCCTTCCCCTCCCAATGCATAGGAAGCAGACTGCGGGCGGTGGCAGGCAGGTGCCCTCTGAGC

TGGCCTGGTGACTTACTCAGAGCTCTGGTCGCCCTTCAAAAGCAGCTGCCTGTTGTATCCAGTTCCTGTTGTTGTATATAGAGCTGCATCGCGTTCCTTG

GCTCTGTAGGAGATTCCTTTGGGAAGTTATTAAGACCGTCCCGCTAGCGTCCCAGTCCTGACCGCTGTAGGAGTCAGGGTGGTGACAGCTGTGCTAGACA

TCAGGGCTCTTCTGATTCACTGAGGTAGAACCCCAGGCTTAAGCGTCATTCATCCCAGTCTGGTCTGGCTGCATCGTGCAGGACACGCCCCCAGACCTGA

CCGCATTCCTGGTGGTTCCGGAAGCTTCCCCTTGCAGCCCCAAGAGCTCACAGCAACAAGGCTGGGCGAGGAGTGTGTGCCTCACCCGGAGTTTGATGCC

CTCTGTCCTCACTGCCCTGACATGGCCTCTGGACCCTCCATGCACCTACAGGATGCTAAGCAAATCTGTGAGCTCGGGGTGGTGTGGTCTACCCTTTGCT

ATCACTCCGTTCTCCTCACCCGAAGCCTTAATCTCCACGAGCACTCCTCCGAGAGCCTGGTTTCAGTACTGCAAGCTGTAGCCTCCTTAATGTCTGAAGT

AGCTTCTGGAATATTCTATGTAGCTCCAAGGTAAAGCACGTGGCAACCCCACCCTCACCCCCCCCCCCCGGCCACTCTCCCCTCCTCTAGGAAGACATGC

CAAAGCTGTATACTTAGCCAATATCGATGTGATACCTGCCAATTAGCTTGTGTCCCGAACCTCCCTCGGTCCCAGTCCCTGGTGGTGCTGGGGTTTGCCT

TCCTCTAGCAACTTTTGATGGAGTCATCTTTCCGCACTGTTTGTAGGGGAGTTGATACAGAGGAAGAGTTGAAACCTGTGCAACAATGTTTTTCCTCCCC

ATGGGTCTACGCTCCATAACATTGGTGTAGCAGGAGGAGACTCTGACCTGAGTGTAGGCAGCCTCTGTGACTGGTCCCATGGGTGACTCTCGCAGTGGTG

TGTCTCAAGGAGTCCTCTGAAGAGCAGGTGGGAAGTCGAAGATGGGGAGTCTAAGAGGGATCCTATAGGACCCGCCTGACCTGGGAATTGTCCTTGTGCC

TGGGTGGAGTCCATACCACGCTGGCTTCTTGGTCTCCCCCCAGGGAACATGTGTCAGTGACCAGGAAATCAGAACTGTATCTATCATTTTCCCTTCCTCC

ATACATCATGATGAAGTATGTTCATTATTCTTCTCTGAAGCACATTCTTTGGCTGAAGCCGCTGTATGATGCTGGGTTCCGCCACATGCCCAGGCTCAGC

ACCTCTGGGAGGCAGCTCCAGGGCTCTGTGTCCTGCTCTTGGTGGCTGTGTCCAACAGAAGCTCTCAGGAACCCAGGCTCTGCGTGTCTGGTTTGTCCCT

GAATCCCAGCCCTCCGGGTTGGATCCGATCCTGTCAGGAGCAGTGGAGTCTGCCTCCTGGCCAGGTGCCCTCCTCCTTGGGCCAGTGTGGGAGTGGCCTT

CCATTCTTCACTCCGCCCTCTCCTTTGATACATACTTTCGAAATGGTAAATTCTTACTGAGAGCTTGTAATTTGGTCCTATTTTATACTCTAGCCTTTAA

TAAAGCCATTTT
Translation
MASMAAAIAASRSAVMSGNRPLDDRERKRFTYFSSLSPMARKIMQDKEKIREKYGPEWARLPPAQQDEIIDRCLVGPRAPAAAADAGDVRDPARFPGLRG

PTGQKLVRFGDE - UNI4377 - DITWQDEHSAPFSWETR SQMEFSISSLSIQEPSAATVTSDARSLAKAPQGTQGSKPAQSSRSSSLDALGPARKE

EEAPFWKINAERSREGPEAEFQSLTPSQIKSMEKGEKVLPACYRQEPTTKDREAKPVPQEQQTLPSVSAEQEVPQPVQAPASLLPKATPTESPEKPPPPA

VQRDEDDDALFSEPALAQ ISSSNVLLKTGFDFLDNW

For any suggestions or comments, please send an email to unitrap@crg.es