Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031997 (Trpc6)
Chromosomal location
Chr 9: 8544142 - 8680741 (+)
Description
transient receptor potential cation channel, subfamily C, member 6 Gene [Source:MGI Symbol;Acc:MGI:109523]
RefSeq_dna
NM_013838 
RefSeq_peptide
NP_038866.2 
UniGene
Mm.325086 
MGI
MGI:109523 
Uniprot/SWISSPROT
Q61143 
Uniprot/SPTREMBL
Q3UZG1 Q6NV56 
Human Ortholog
not available
Omim not available
UniTrap UNI35786
Vector Insertion
Chr 9: 8626776 - 8634046
Public Clones IST14043H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34678
Vector Insertion
Chr 9: 8658378 - 8677923
Public Clones PST19651-NL (escells) IST13806B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098989
Sequence
CGCCTGTGCCCTCTGCCTGGGAGCCTGGGGCCGCCTGTCTGCGCGGTCCGGATGCGCTCAGGTCAAGGTTCCTTTCGCGGCTGTCTCCCAAGCCCCTAAC

TAGTGACTTCCACTGTGGCGGGCAGGGAAGCCATTGGCAGAACCTAGCCAGTCAGGAATCTGCATCTCTTCCCTCATTATCCTCTCCCTGGCATTGCTTT

GCTCGGGTCCAGCTCAGTTGGTGACGCGGCCCCTTCTCCCCAGGTTCCCATCCACGGAAGCAGGGGTGCAGGCCGGCCAGGCACTGTGCCATGAGCCAGA

GCCCGAGGTTCGTGACCCGGAGGGGCGGCTCTCTAAAGGCTGCCCCTGGAGCCGGCACCCGGCGCAACGAGAGCCAGGACTATTTGCTGATGGACGAGCT

GGGAGACGACGGCTACCCGCAGCTCCCGCTGCCACCGTATGGCTACTACCCCAGCTT CCGGGGTAATGAAAACAGACTGACTCACCGGCGGCAGACGAT

TCTTCGTGAGAAGGGAAGAAGGTTAGCTAATCGAGGACCAGCATACATGTTTAATGATCATTCAACAAGCCTGTCTATTGAGGAAGAACGCTTTCTAGAT

GCAGCTGAATATGGCAACATCCCAGTGGTGCGGAAGATGCTAGAAGAGTGTCATTCCCTCAATGTTAACTGTGTGGATTACATGGGCCAGAATGCCCTAC

AGCTGGCTGTGGCCAATGAGCACTTGGAAATCACAGAGCTGCTACTCAAGAAGGAAAACTTGTCTCGAGTTGGGGATGCTTTACTTTTAGCCATTAGTAA

AGGTTATGTACGGATTGTGGAGGCAATCCTCAACCATCCAGCTTTTGCTGAAGGCAAAAGGTTAGCGACAAGCCCCAGCCAGTCTGAACTTCAGCAAGAT

GACTTTTATGCCTATGATGAAGATGGGACGCGGTTCTCCCATGATGTGACCCCAATCATTCTCGCTGCACATTGCCAGGAATATGAAATTGTGCATACCC

TCCTGAGAAAGGGTGCCCGGATTGAGCGGCCTCATGATTACTTCTGCAAGTGTACAGAATGCAGCCAGAAGCAGAAGCATGATTCCTTCAGCCACTCTAG

ATCCAGGATCAATGCATACAAAGGTCTGGCAAGTCCAGCATACCTGTCATTGTCCAGTGAAGATCCAGTCATGACTGCTTTAGAACTTAGCAATGAGCTG

GCAGTGCTTGCCAACATTGAGAAAGAGTTCAAG AATGACTACAGGAAGCTGTCTATGCAGTGCAAGGATTTCGTTGTTGGTCTCTTGGACCTCTGCAGA

AACACAGAGGAAGTGGAGGCCATCCTGAATGGGGATGCAGAGACTCGCCAGCCCGGGGACTTCGGCCGTCCAAATCTCAGCCGTTTAAAACTTGCTATTA

AGTATGAAGTAAAAAAA - UNI35786 - TTTGTGGCTCATCCAAACTGTCAGCAACAGCTCCTGTCCATATGGTATGAGAACCTCTCTGGTTTACGG

CAGCAGACCATGGCAGTGAAGTTCCTCGTGGTCCTTGCTGTTGCCATTGGATTGCCCTTCCTGGCTCTCATATACTGGTGTGCTCCTTGCAGCAAG ATG

GGGAAGATATTGCGAGGACCGTTCATGAAGTTTGTAGCACACGCAGCCTCCTTCACCATTTTCCTGGGGCTGCTCGTCATGAATGCAGCTGACAGATTTG

AAGGCACCAAGCTCCTCCCTAATGAAACCAGCACAGATAATGCAAGGCAGCTGTTCAGGATGAAAACATCCTGTTTCTCATGGATGGAGATGCTCATTAT

ATCCTGGGTAATAG CCAGGATAAAGTGGGACCCTACTGATCCTCAGATCATCTCTGAAGGTCTTTATGCAATCGCTGTGGTTTTAAGTTTCTCCAGAAT

AGCTTACATTTTACCAGCAAATGAAAGCTTTGGACCTCTGCAGATTTCACTTGGAAGAACAGTGAAAGATATCTTCAAATTCATGGTCATATTCATCATG

GTGTTTGTAGCCTTTATGATTGGAATGTTCAACCTTTACTCCTACTACATTGGCGCAAAACAGAATGAAGCATTCACAAC AGTTGAGGAAAGTTTTAAG

ACACTGTTCTGGGCTATCTTTGGTCTTTCTGAAGTGAAGTCAGTGGTCATTAACTACAATCACAAGTTCATTGAAAACATCGGCTACGTTCTGTATGGTG

TCTATAATGTCACAATGGTCATTGTTTTGCTAAATATGTTAATTGCGATGATCAATAGTTCATTCCAGGAAATTGAG GATGATGCGGACGTGGAGTGGA

AGTTTGCAAGGGCCAAATTGTGGTTTTCCTACTTTGAGGAGGGGAGAACACTTCCTGTCCCCTTCAATCTTGTACCAAGTCCAAAATCCTTGCTTTATCT

CCTATTGAAATTTAAGAAATGGATGTGTGAGCTCATCCAGGGTCAAAAGCAAGGCTTCCAAGAAGATGCAGAGATGAACAAG AGAAATGAAGAAAAGAA

ATTTGGAATTTCAGGAAGTCACGAAGACCTTTCAAAATTTTCACTTGACAAAAATCAG - UNI34677 - TTGGCACACAACAAACAATCAAGTACAA

GGAGCTCAGAAGATTATCATTTAAATAGTTTCAGTAACCCTCCAAGACAATATCAG AAAATCATGAAGAGACTCATTAAAAGATATGTATTGCAGGCCC

AGATTGATAAGGAGAGCGATGAGGTGAATGAAG GGGAATTGAAGGAAATTAAGCAAGACATCTCAAGTCTCCGTTATGAACTCCTTGAAGAGAAATCAC

AGAACACAGAAGACCTAGCAGAGCTCATTAGAAAACTCGGGGAGAGACTGTCGTTAGAGCCAAAGCTGGAGGAAAGCCGCAGATAGAGCAGAGCCCCTCA

GAAGTGCATATTTATTTCTCCACTTGAAGCCATATTATTTTCTGACTTATTTTTTTAAGTGTCAATGATAAAAAGTATGTTAACTGATAACTTGGATCAT

TTAGAGTCCTAATATCAACTTTTTGGGTGATTAAATTGCATTGCTGAGGCTAACAATTGCTG
Translation
MSQSPRFVTRRGGSLKAAPGAGTRRNESQDYLLMDELGDDGYPQLPLPPYGYYPSF FRGNENRLTHRRQTILREKGRRLANRGPAYMFNDHSTSLSIEE

ERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILNHPAFAEGKRLATSPSQS

ELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALE

LSNELAVLANIEKEFK NDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRPNLSRLKLAIKYEVKK - UNI35786 - FVAHPNCQ

QQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWCAPCSK MGKILRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNARQL

FRMKTSCFSWMEMLIISWVIA ARIKWDPTDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY

IGAKQNEAFTT TVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIE DDADVEWKFARAKLWFSYFEE

GRTLPVPFNLVPSPKSLLYLLLKFKKWMCELIQGQKQGFQEDAEMNK RNEEKKFGISGSHEDLSKFSLDKNQ - UNI34677 - LAHNKQSSTRSSE

DYHLNSFSNPPRQYQ KIMKRLIKRYVLQAQIDKESDEVNEG GELKEIKQDISSLRYELLEEKSQNTEDLAELIRKLGERLSLEPKLEESRR
Transcript ENSMUST00000050433
Sequence
CGCCTGTGCCCTCTGCCTGGGAGCCTGGGGCCGCCTGTCTGCGCGGTCCGGATGCGCTCAGGTCAAGGTTCCTTTCGCGGCTGTCTCCCAAGCCCCTAAC

TAGTGACTTCCACTGTGGCGGGCAGGGAAGCCATTGGCAGAACCTAGCCAGTCAGGAATCTGCATCTCTTCCCTCATTATCCTCTCCCTGGCATTGCTTT

GCTCGGGTCCAGCTCAGTTGGTGACGCGGCCCCTTCTCCCCAGGTTCCCATCCACGGAAGCAGGGGTGCAGGCCGGCCAGGCACTGTGCCATGAGCCAGA

GCCCGAGGTTCGTGACCCGGAGGGGCGGCTCTCTAAAGGCTGCCCCTGGAGCCGGCACCCGGCGCAACGAGAGCCAGGACTATTTGCTGATGGACGAGCT

GGGAGACGACGGCTACCCGCAGCTCCCGCTGCCACCGTATGGCTACTACCCCAGCTT CCGGGGTAATGAAAACAGACTGACTCACCGGCGGCAGACGAT

TCTTCGTGAGAAGGGAAGAAGGTTAGCTAATCGAGGACCAGCATACATGTTTAATGATCATTCAACAAGCCTGTCTATTGAGGAAGAACGCTTTCTAGAT

GCAGCTGAATATGGCAACATCCCAGTGGTGCGGAAGATGCTAGAAGAGTGTCATTCCCTCAATGTTAACTGTGTGGATTACATGGGCCAGAATGCCCTAC

AGCTGGCTGTGGCCAATGAGCACTTGGAAATCACAGAGCTGCTACTCAAGAAGGAAAACTTGTCTCGAGTTGGGGATGCTTTACTTTTAGCCATTAGTAA

AGGTTATGTACGGATTGTGGAGGCAATCCTCAACCATCCAGCTTTTGCTGAAGGCAAAAGGTTAGCGACAAGCCCCAGCCAGTCTGAACTTCAGCAAGAT

GACTTTTATGCCTATGATGAAGATGGGACGCGGTTCTCCCATGATGTGACCCCAATCATTCTCGCTGCACATTGCCAGGAATATGAAATTGTGCATACCC

TCCTGAGAAAGGGTGCCCGGATTGAGCGGCCTCATGATTACTTCTGCAAGTGTACAGAATGCAGCCAGAAGCAGAAGCATGATTCCTTCAGCCACTCTAG

ATCCAGGATCAATGCATACAAAGGTCTGGCAAGTCCAGCATACCTGTCATTGTCCAGTGAAGATCCAGTCATGACTGCTTTAGAACTTAGCAATGAGCTG

GCAGTGCTTGCCAACATTGAGAAAGAGTTCAAG AATGACTACAGGAAGCTGTCTATGCAGTGCAAGGATTTCGTTGTTGGTCTCTTGGACCTCTGCAGA

AACACAGAGGAAGTGGAGGCCATCCTGAATGGGGATGCAGAGACTCGCCAGCCCGGGGACTTCGGCCGTCCAAATCTCAGCCGTTTAAAACTTGCTATTA

AGTATGAAGTAAAAAAA - UNI35786 - TTTGTGGCTCATCCAAACTGTCAGCAACAGCTCCTGTCCATATGGTATGAGAACCTCTCTGGTTTACGG

CAGCAGACCATGGCAGTGAAGTTCCTCGTGGTCCTTGCTGTTGCCATTGGATTGCCCTTCCTGGCTCTCATATACTGGTGTGCTCCTTGCAGCAAG ATG

GGGAAGATATTGCGAGGACCGTTCATGAAGTTTGTAGCACACGCAGCCTCCTTCACCATTTTCCTGGGGCTGCTCGTCATGAATGCAGCTGACAGATTTG

AAGGCACCAAGCTCCTCCCTAATGAAACCAGCACAGATAATGCAAGGCAGCTGTTCAGGATGAAAACATCCTGTTTCTCATGGATGGAGATGCTCATTAT

ATCCTGGGTAATAG GCATGATATGGGCTGAATGTAAAGAAATCTGGACTCAAGGCCCCAAAGAATACTTATTTGAGTTGTGGAATATGCTTGACTTTGG

AATGCTGGCAATCTTTGCAGCATCATTCATTGCAAGATTTATGGCGTTCTGGCATGCATCCAAAGCTCAGAGCATCATTGATGCAAATGATACTTTAAAG

GATTTGACAAAAGTCACACTGGGGGACAACGTTAAATACTACAATCTGG CCAGGATAAAGTGGGACCCTACTGATCCTCAGATCATCTCTGAAGGTCTT

TATGCAATCGCTGTGGTTTTAAGTTTCTCCAGAATAGCTTACATTTTACCAGCAAATGAAAGCTTTGGACCTCTGCAGATTTCACTTGGAAGAACAGTGA

AAGATATCTTCAAATTCATGGTCATATTCATCATGGTGTTTGTAGCCTTTATGATTGGAATGTTCAACCTTTACTCCTACTACATTGGCGCAAAACAGAA

TGAAGCATTCACAAC AGTTGAGGAAAGTTTTAAGACACTGTTCTGGGCTATCTTTGGTCTTTCTGAAGTGAAGTCAGTGGTCATTAACTACAATCACAA

GTTCATTGAAAACATCGGCTACGTTCTGTATGGTGTCTATAATGTCACAATGGTCATTGTTTTGCTAAATATGTTAATTGCGATGATCAATAGTTCATTC

CAGGAAATTGAG GATGATGCGGACGTGGAGTGGAAGTTTGCAAGGGCCAAATTGTGGTTTTCCTACTTTGAGGAGGGGAGAACACTTCCTGTCCCCTTC

AATCTTGTACCAAGTCCAAAATCCTTGCTTTATCTCCTATTGAAATTTAAGAAATGGATGTGTGAGCTCATCCAGGGTCAAAAGCAAGGCTTCCAAGAAG

ATGCAGAGATGAACAAG AGAAATGAAGAAAAGAAATTTGGAATTTCAGGAAGTCACGAAGACCTTTCAAAATTTTCACTTGACAAAAATCAG - UNI3

4677 - TTGGCACACAACAAACAATCAAGTACAAGGAGCTCAGAAGATTATCATTTAAATAGTTTCAGTAACCCTCCAAGACAATATCAG AAAATCAT

GAAGAGACTCATTAAAAGATATGTATTGCAGGCCCAGATTGATAAGGAGAGCGATGAGGTGAATGAAG GGGAATTGAAGGAAATTAAGCAAGACATCTC

AAGTCTCCGTTATGAACTCCTTGAAGAGAAATCACAGAACACAGAAGACCTAGCAGAGCTCATTAGAAAACTCGGGGAGAGACTGTCGTTAGAGCCAAAG

CTGGAGGAAAGCCGCAGATAGAGCAGAGCCCCTCAGAAGTGCATATTTATTTCTCCACTTGAAGCCATATTATTTTCTGACTTATTTTTTTAAGTGTCAA

TGATAAAAAGTATGTTAACTGATAACTTGGATCATTTAGAGTCCTAATATCAACTTTTTGGGTGATTAAATTGCATTGCTGAGGCTAACAATTGCTG
Translation
MSQSPRFVTRRGGSLKAAPGAGTRRNESQDYLLMDELGDDGYPQLPLPPYGYYPSF FRGNENRLTHRRQTILREKGRRLANRGPAYMFNDHSTSLSIEE

ERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILNHPAFAEGKRLATSPSQS

ELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALE

LSNELAVLANIEKEFK NDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRPNLSRLKLAIKYEVKK - UNI35786 - FVAHPNCQ

QQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWCAPCSK MGKILRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNARQL

FRMKTSCFSWMEMLIISWVIG GMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNL

A ARIKWDPTDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYIGAKQNEAFTT TVEESFKT

LFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIE DDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLLYL

LLKFKKWMCELIQGQKQGFQEDAEMNK RNEEKKFGISGSHEDLSKFSLDKNQ - UNI34677 - LAHNKQSSTRSSEDYHLNSFSNPPRQYQ KIMK

RLIKRYVLQAQIDKESDEVNEG GELKEIKQDISSLRYELLEEKSQNTEDLAELIRKLGERLSLEPKLEESRR

For any suggestions or comments, please send an email to unitrap@crg.es