Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032000 (Birc3)
Chromosomal location
Chr 9: 7848707 - 7873127 (-)
Description
baculoviral IAP repeat-containing 3 Gene [Source:MGI (curated);Acc:Birc3-001]
RefSeq_dna
NM_007464 
RefSeq_peptide
NP_031490.2 
UniGene
Mm.471518 
MGI
MGI:1197007 
Uniprot/SWISSPROT
O08863 
Uniprot/SPTREMBL
A2CGA3 Q921N0 A2CGA4 A2CGA5 Q3T9B6 
Human Ortholog
ENSG00000023445 (BIRC3)
Omim not available
UniTrap UNI36335
Vector Insertion
Chr 9: 7872822 - 7873128
Public Clones IST12279H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33458
Vector Insertion
Chr 9: 7860462 - 7872984
Public Clones IST15090E7 (tigm) IST14123F5 (tigm) IST11618F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33754
Vector Insertion
Chr 9: 7850919 - 7854607
Public Clones IST12334B6 (tigm) IST13439H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115672
Sequence
GCAGCCCTGAGCCGGGCAGGGTGGGGGCAGTGGCTAAGGCCTAGCTGGGGACGATTTAAAGGTATCGCGCCACCCAGCCACACCCCACAGGCCAGGCGAG

GGTGCCACCCCCGGAGATCAGAGGTCATTGCTGGCGTTCAGAGCCTAGGAAGTGGGCTGCG - UNI33458 - - UNI36335 - GTATCAGCCTAG

CAGTAAAACCGACCAGAAGCCATGCACAAAACTACATCCCCAGAGAAAGACTTGTCCCTTCCCCTCCCTGTCATCTCACCATGAACATGGTTCAAGACAG

CGCCTTTCTAGCCAAGCTGATGAAGAGTGCTGACACCTTTGAGTTGAAGTATGACTTTTCCTGTGAGCTGTACCGATTGTCCACGTATTCAGCTTTTCCC

AGGGGAGTTCCTGTGTCAGAAAGGAGTCTGGCTCGTGCTGGCTTTTACTACACTGGTGCCAATGACAAGGTCAAGTGCTTCTGCTGTGGCCTGATGCTAG

ACAACTGGAAACAAGGGGACAGTCCCATGGAGAAGCACAGAAAGTTGTACCCCAGCTGCAACTTTGTACAGACTTTGAATCCAGCCAACAGTCTGGAAGC

TAGTCCTCGGCCTTCTCTTCCTTCCACGGCGATGAGCACCATGCCTTTGAGCTTTGCAAGTTCTGAGAATACTGGCTATTTCAGTGGCTCTTACTCGAGC

TTTCCCTCAGACCCTGTGAACTTCCGAGCAAATCAAGATTGTCCTGCTTTGAGCACAAGTCCCTACCACTTTGCAATGAACACAGAGAAGGCCAGATTAC

TCACCTATGAAACATGGCCATTGTCTTTTCTGTCACCAGCAAAGCTGGCCAAAGCAGGCTTCTACTACATAGGACCTGGAGATAGAGTGGCCTGCTTTGC

GTGCGATGGGAAACTGAGCAACTGGGAACGTAAGGATGATGCTATGTCAGAGCACCAGAGGCATTTCCCCAGCTGTCCGTTCTTAAAAGACTTGGGTCAG

TCTGCTTCGAGATACACTGTCTCTAACCTGAGCATGCAGACACACGCAGCCCGTATTAGAACATTCTCTAACTGGCCTTCTAGTGCACTAGTTCATTCCC

AGGAACTTGCAAGTGCGGGCTTTTATTATACAG - UNI33458 - GACACAGTGATGATGTCAAGTGTTTTTGCTGTGATGGTGGGCTGAGGTGCTGG

GAATCTGGAGATGACCCCTGGGTGGAACATGCCAAGTGGTTTCCAAG GTGTGAGTACTTGCTCAGAATCAAAGGCCAAGAATTTGTCAGCCAAGTTCAA

GCTGGCTATCCTCATCTACTTGAGCAG CTATTATCTACGTCAGACTCCCCAGAAGATGAGAATGCAGACGCAGCAAGTATGTATAATAATCATAATTCC

TGCATTACACTGCTCTGTTTTGCATAAGGTTGAAGGGAAGCTGAGTCCAGCTGTAATCCAGCATTTGGAAAGCAGAAGTGGAAGGCTGATGTGCTCAAGG

CCCTATTGAATTATGTGAGACCTTGTCCTAGAAATACACATGATTGGAAGGTTATCATAGGAAAGAAATATGCATGTTGATTTCTAATGTATATAAGCAA

CAAGAGTTGCTTGGAGAAATTTATTTATTTATTTAAAAGATTTATTTATTATTATATCTAAGTACACTGTAGCTGTCTTCAGATGCACCAAAAGAGGGCA

TCAGATCTCATTACAGATGGTTGTGAGCCACCATGTGGTTGCTGGGAATTGAACTCAGGACCTTTGGAAGAGCAGTCAGTGCTCTTAACCACTGAGCCAT

CTCTCCAGCCCGCTTGGAGAAATTTAAAAAACAGCATAAATATCTAGTTTATGCTTCAGGCCTCATAGATTGATCAGTGTATGTAAGTGTGTATCTTGGG

TCTCTATGTATAATTGTTTTTTATGCTCCTGGGGGTTGAACCTAGGACCTCAGGCATGCCAATCATAACCTCTTTCCCTAGCTCCACCCCATAGCAGTGG

GCATCTACACTTTAAGCAAACTACATTCATCTAGCCTTACCCTGTTGTTGGGCAGTTGTGGAAATACGTATACTGTGCCTTCTATTGCTGGCATACTCTT

CCTGTCCGTAGAAAGGGTAGAACACAGAATTCGAATTTTTTCACTGGGCGCAGATTGCCAATGGAACTTACTTGTTACTTAGACCCGAGCGGATGGAGCA

GTCGTTTGAATAGGTGCCTTGACCTTATGTTTTAGTGCTCAGTGCAATACATTTTAATCATTTGTTTACTTTCATGTATGTGCATTGGTGTTTTGCCTGC

TAGTATGTTTGTGTGAAGTGTCAGGTCCCCTGGAACTGGAGTTAAAGACAGTTGAGAGCTGTCACTGAATGCTAGGAATTGAACCTGGGTCCTCTGGAAG

AGCAGTCAGTACCCTTAACCACTGAGTCATCTCTCTAGCCCATAAGCCCATATGGCCCTGTTGATTTTTGTTGTTGATGTTGTTCAAAGGAAAGAATAAA

AAACAAGATAAGCATGTGACTTCTCATGAGCTAATGCCATTGGGGACAGATAATGCCCAGCTAATAGAACAGGGTCTGAAGGAGAACGTGAAGAGACAAC

TGTCTAAATCTGGGGAACACAAAAGGCTTTCTAGGAGGCCAAATGTGGCAGCATCTGTCTGGGGCAGGGCCAGCAATCTAAGTACTTGGAGGGTTAAGGC

ACAGGGTCATACATTCCTAGCCAGCCGGGGTTATACAGTGAGTGGCCAGCCTGGATAACCTACTGAAACCTTGTCTTAAAAGAACAAACCAAGGTTGGCA

GATGACTCAGCCCAGGTTGTAGCCCCTGGACTCACATGGTCGAGGGGAAAGCTGACTCTTGAAAGTTGTCCTCTGACTACCCACGTGCCATAGTGCACAC

ATTCCTTCTCAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAA
Translation
 - UNI33458 - - UNI36335 - MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGANDKVKCFCCGLML

DNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMSTMPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARL

LTYETWPLSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQSASRYTVSNLSMQTHAARIRTFSNWPSSALVHS

QELASAGFYYTG - UNI33458 - GHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPR RCEYLLRIKGQEFVSQVQAGYPHLLEQ LLSTSDSPEDE

NADAASMYNNHNSCITLLCFA
Transcript ENSMUST00000115673
Sequence
GAAGAGGAGCTGGGTCCAGGAAGTCACGCACAGAAGAGCCACGGAAATCCCCAGCCAGGGTGGCCACCAAGGGTGAGGAGGAAGTGCGTCTGGTTTTCAC

CCTGGAGTTCCCCGGAGCCCTGGAGGAAAGCACCGCAG - UNI33458 - - UNI36335 - GTATCAGCCTAGCAGTAAAACCGACCAGAAGCCAT

GCACAAAACTACATCCCCAGAGAAAGACTTGTCCCTTCCCCTCCCTGTCATCTCACCATGAACATGGTTCAAGACAGCGCCTTTCTAGCCAAGCTGATGA

AGAGTGCTGACACCTTTGAGTTGAAGTATGACTTTTCCTGTGAGCTGTACCGATTGTCCACGTATTCAGCTTTTCCCAGGGGAGTTCCTGTGTCAGAAAG

GAGTCTGGCTCGTGCTGGCTTTTACTACACTGGTGCCAATGACAAGGTCAAGTGCTTCTGCTGTGGCCTGATGCTAGACAACTGGAAACAAGGGGACAGT

CCCATGGAGAAGCACAGAAAGTTGTACCCCAGCTGCAACTTTGTACAGACTTTGAATCCAGCCAACAGTCTGGAAGCTAGTCCTCGGCCTTCTCTTCCTT

CCACGGCGATGAGCACCATGCCTTTGAGCTTTGCAAGTTCTGAGAATACTGGCTATTTCAGTGGCTCTTACTCGAGCTTTCCCTCAGACCCTGTGAACTT

CCGAGCAAATCAAGATTGTCCTGCTTTGAGCACAAGTCCCTACCACTTTGCAATGAACACAGAGAAGGCCAGATTACTCACCTATGAAACATGGCCATTG

TCTTTTCTGTCACCAGCAAAGCTGGCCAAAGCAGGCTTCTACTACATAGGACCTGGAGATAGAGTGGCCTGCTTTGCGTGCGATGGGAAACTGAGCAACT

GGGAACGTAAGGATGATGCTATGTCAGAGCACCAGAGGCATTTCCCCAGCTGTCCGTTCTTAAAAGACTTGGGTCAGTCTGCTTCGAGATACACTGTCTC

TAACCTGAGCATGCAGACACACGCAGCCCGTATTAGAACATTCTCTAACTGGCCTTCTAGTGCACTAGTTCATTCCCAGGAACTTGCAAGTGCGGGCTTT

TATTATACAG - UNI33458 - GACACAGTGATGATGTCAAGTGTTTTTGCTGTGATGGTGGGCTGAGGTGCTGGGAATCTGGAGATGACCCCTGGGT

GGAACATGCCAAGTGGTTTCCAAG GTGTGAGTACTTGCTCAGAATCAAAGGCCAAGAATTTGTCAGCCAAGTTCAAGCTGGCTATCCTCATCTACTTGA

GCAG CTATTATCTACGTCAGACTCCCCAGAAGATGAGAATGCAGACGCAGCAA - UNI33754 - TCGTGCATTTTGGCCCTGGAGAAAGTTCGGAA

GATGTCGTCATGATGAGCACGCCTGTGGTTAAAGCAGCCTTGGAAATGGGCTTCAGTAGGAGCCTGGTGAGACAGACGGTTCAGTGGCAGATCCTGGCCA

CTGGTGAGAACTACAGGACCGTCAGTGACCTCGTTATAGGCTTACTCGATGCAGAAGACGAGATGA
Translation
 - UNI33458 - - UNI36335 - MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGANDKVKCFCCGLML

DNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMSTMPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARL

LTYETWPLSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQSASRYTVSNLSMQTHAARIRTFSNWPSSALVHS

QELASAGFYYTG - UNI33458 - GHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPR RCEYLLRIKGQEFVSQVQAGYPHLLEQ LLSTSDSPEDE

NADAAI - UNI33754 - IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLLDAEDEM
Transcript ENSMUST00000115674
Sequence
GGAGTTCCCCGGAGCCCTGGAGGAAAGCACCGCAGGTCTGAGCAGCCCTGAGCCGGGCAGGGTGGGGGCAGTGGCTAAGGCCTAGCTGGGGACGATTTAA

AGGTATCGCGCCACCCAGCCACACCCCACAGGCCAGGCGAGGGTGCCACCCCCGGAGATCAGAGGTCATTGCTGGCGTTCAGAGCCTAGGAAGTGGGCTG

CG - UNI33458 - - UNI36335 - GTATCAGCCTAGCAGTAAAACCGACCAGAAGCCATGCACAAAACTACATCCCCAGAGAAAGACTTGTCCCT

TCCCCTCCCTGTCATCTCACCATGAACATGGTTCAAGACAGCGCCTTTCTAGCCAAGCTGATGAAGAGTGCTGACACCTTTGAGTTGAAGTATGACTTTT

CCTGTGAGCTGTACCGATTGTCCACGTATTCAGCTTTTCCCAGGGGAGTTCCTGTGTCAGAAAGGAGTCTGGCTCGTGCTGGCTTTTACTACACTGGTGC

CAATGACAAGGTCAAGTGCTTCTGCTGTGGCCTGATGCTAGACAACTGGAAACAAGGGGACAGTCCCATGGAGAAGCACAGAAAGTTGTACCCCAGCTGC

AACTTTGTACAGACTTTGAATCCAGCCAACAGTCTGGAAGCTAGTCCTCGGCCTTCTCTTCCTTCCACGGCGATGAGCACCATGCCTTTGAGCTTTGCAA

GTTCTGAGAATACTGGCTATTTCAGTGGCTCTTACTCGAGCTTTCCCTCAGACCCTGTGAACTTCCGAGCAAATCAAGATTGTCCTGCTTTGAGCACAAG

TCCCTACCACTTTGCAATGAACACAGAGAAGGCCAGATTACTCACCTATGAAACATGGCCATTGTCTTTTCTGTCACCAGCAAAGCTGGCCAAAGCAGGC

TTCTACTACATAGGACCTGGAGATAGAGTGGCCTGCTTTGCGTGCGATGGGAAACTGAGCAACTGGGAACGTAAGGATGATGCTATGTCAGAGCACCAGA

GGCATTTCCCCAGCTGTCCGTTCTTAAAAGACTTGGGTCAGTCTGCTTCGAGATACACTGTCTCTAACCTGAGCATGCAGACACACGCAGCCCGTATTAG

AACATTCTCTAACTGGCCTTCTAGTGCACTAGTTCATTCCCAGGAACTTGCAAGTGCGGGCTTTTATTATACAG - UNI33458 - GACACAGTGATG

ATGTCAAGTGTTTTTGCTGTGATGGTGGGCTGAGGTGCTGGGAATCTGGAGATGACCCCTGGGTGGAACATGCCAAGTGGTTTCCAAG GTGTGAGTACT

TGCTCAGAATCAAAGGCCAAGAATTTGTCAGCCAAGTTCAAGCTGGCTATCCTCATCTACTTGAGCAG CTATTATCTACGTCAGACTCCCCAGAAGATG

AGAATGCAGACGCAGCAA - UNI33754 - TCGTGCATTTTGGCCCTGGAGAAAGTTCGGAAGATGTCGTCATGATGAGCACGCCTGTGGTTAAAGCA

GCCTTGGAAATGGGCTTCAGTAGGAGCCTGGTGAGACAGACGGTTCAGTGGCAGATCCTGGCCACTGGTGAGAACTACAGGACCGTCAGTGACCTCGTTA

TAGGCTTACTCGATGCAGAAGACGAGATGAGAGAGGAGCAGATGGAGCAGGCGGCCGAGGAGGAGGAGTCAG - UNI33754 - ATGATCTAGCACTA

ATCCGGAAGAACAAAATGGTGCTTTTCCAACATTTGACGTGTGTGACACCAATGCTGTATTGCCTCCTAAGTGCAAGGGCCATCACTGAACAGGAGTGCA

ATGCTGTGAAACAGAAACCACACACCTTACAAGCAAGCACACTGATTGATACTGTGTTAGCAAAAGGAAACACTGCAGCAACCTCATTCAGAAACTCCCT

TCGGGAAATTGACCCTGCGTTATACAGAGATATATTTG - UNI33754 - TGCAACAGGACATTAGGAGTCTTCCCACAGATGACATTGCAG CTCTA

CCAATGGAAGAACAGTTGCGGAAACTCCAGGAGGAAAGAATGTGTAAAGTGTGTATGGACCGAGAGGTATCCATCGTGTTCATTCCCTGTGGCCATCTGG

TCGTGTGCAAAGACTGCGCTCCCTCTCTGAGGAAGTGTCCCATCTGTAGAGGGACCATCAAGGGCACAGTGCGCACATTTCTCTCCTGAACAAGACTAAT

GGTCCATGGCTGCAACTTCAGCCAGGAGGAAGTTCACTGTCACTCCCAGCTCCATTCGGAACTTGAGGCCAGCCTGGATAGCACGAGACACCGCCAAACA

CACAAATATAAACATGAAAAACTTTTGTCTGAAGTCAAGAATGAATGAATTACTTATATAATAATTTTAATTGGTTTCCTTAAAAGTGCTATTTGTTCCC

AACTCAGAAAATTGTTTTCTGTAAACATATTTACATACTACCTGCATCTAAAGTATTCATATATTCATATATTCAGATGTCATGAGAGAGGGTTTTGTTC

TTGTTCCTGAAAAGCAGGGATTGCCTGCACTCCTGAAATTCTCAGAAAGATTTACAATGTTGGCATTTATGGTTCAGAAACTAGAATCTTCTCCCGTTGC

TTTAAGAACCGGGAGCACAGATGTCCATGTGTTTTATGTATAGAAATTCCTGTTATTTATTGGATGACATTTTAGGGATATGAAATTTTTATAAAGAATT

TGTGAGAAAAAGTTAATAAAGCAACATAATTACCTCTTTTTTTTT
Translation
 - UNI33458 - - UNI36335 - MVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGANDKVKCFCCGLMLDN

WKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMSTMPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARLLT

YETWPLSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQSASRYTVSNLSMQTHAARIRTFSNWPSSALVHSQE

LASAGFYYTG - UNI33458 - GHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPR RCEYLLRIKGQEFVSQVQAGYPHLLEQ LLSTSDSPEDENA

DAAI - UNI33754 - IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLLDAEDEMREEQMEQAAEEEESD 

- UNI33754 - DDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECNAVKQKPHTLQASTLIDTVLAKGNTAATSFRNSLREIDPALYRDIFV -

 UNI33754 - VQQDIRSLPTDDIAA ALPMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTFLS
Transcript ENSMUST00000013949
Sequence
GGAGTTCCCCGGAGCCCTGGAGGAAAGCACCGCAGGTCTGAGCAGCCCTGAGCCGGGCAGGGTGGGGGCAGTGGCTAAGGCCTAGCTGGGGACGATTTAA

AGGTATCGCGCCACCCAGCCACACCCCACAGGCCAGGCGAGGGTGCCACCCCCGGAGATCAGAGGTCATTGCTGGCGTTCAGAGCCTAGGAAGTGGGCTG

CG - UNI33458 - - UNI36335 - GTATCAGCCTAGCAGTAAAACCGACCAGAAGCCATGCACAAAACTACATCCCCAGAGAAAGACTTGTCCCT

TCCCCTCCCTGTCATCTCACCATGAACATGGTTCAAGACAGCGCCTTTCTAGCCAAGCTGATGAAGAGTGCTGACACCTTTGAGTTGAAGTATGACTTTT

CCTGTGAGCTGTACCGATTGTCCACGTATTCAGCTTTTCCCAGGGGAGTTCCTGTGTCAGAAAGGAGTCTGGCTCGTGCTGGCTTTTACTACACTGGTGC

CAATGACAAGGTCAAGTGCTTCTGCTGTGGCCTGATGCTAGACAACTGGAAACAAGGGGACAGTCCCATGGAGAAGCACAGAAAGTTGTACCCCAGCTGC

AACTTTGTACAGACTTTGAATCCAGCCAACAGTCTGGAAGCTAGTCCTCGGCCTTCTCTTCCTTCCACGGCGATGAGCACCATGCCTTTGAGCTTTGCAA

GTTCTGAGAATACTGGCTATTTCAGTGGCTCTTACTCGAGCTTTCCCTCAGACCCTGTGAACTTCCGAGCAAATCAAGATTGTCCTGCTTTGAGCACAAG

TCCCTACCACTTTGCAATGAACACAGAGAAGGCCAGATTACTCACCTATGAAACATGGCCATTGTCTTTTCTGTCACCAGCAAAGCTGGCCAAAGCAGGC

TTCTACTACATAGGACCTGGAGATAGAGTGGCCTGCTTTGCGTGCGATGGGAAACTGAGCAACTGGGAACGTAAGGATGATGCTATGTCAGAGCACCAGA

GGCATTTCCCCAGCTGTCCGTTCTTAAAAGACTTGGGTCAGTCTGCTTCGAGATACACTGTCTCTAACCTGAGCATGCAGACACACGCAGCCCGTATTAG

AACATTCTCTAACTGGCCTTCTAGTGCACTAGTTCATTCCCAGGAACTTGCAAGTGCGGGCTTTTATTATACAG - UNI33458 - GACACAGTGATG

ATGTCAAGTGTTTTTGCTGTGATGGTGGGCTGAGGTGCTGGGAATCTGGAGATGACCCCTGGGTGGAACATGCCAAGTGGTTTCCAAG GTGTGAGTACT

TGCTCAGAATCAAAGGCCAAGAATTTGTCAGCCAAGTTCAAGCTGGCTATCCTCATCTACTTGAGCAG CTATTATCTACGTCAGACTCCCCAGAAGATG

AGAATGCAGACGCAGCAA - UNI33754 - TCGTGCATTTTGGCCCTGGAGAAAGTTCGGAAGATGTCGTCATGATGAGCACGCCTGTGGTTAAAGCA

GCCTTGGAAATGGGCTTCAGTAGGAGCCTGGTGAGACAGACGGTTCAGTGGCAGATCCTGGCCACTGGTGAGAACTACAGGACCGTCAGTGACCTCGTTA

TAGGCTTACTCGATGCAGAAGACGAGATGAGAGAGGAGCAGATGGAGCAGGCGGCCGAGGAGGAGGAGTCAG - UNI33754 - ATGATCTAGCACTA

ATCCGGAAGAACAAAATGGTGCTTTTCCAACATTTGACGTGTGTGACACCAATGCTGTATTGCCTCCTAAGTGCAAGGGCCATCACTGAACAGGAGTGCA

ATGCTGTGAAACAGAAACCACACACCTTACAAGCAAGCACACTGATTGATACTGTGTTAGCAAAAGGAAACACTGCAGCAACCTCATTCAGAAACTCCCT

TCGGGAAATTGACCCTGCGTTATACAGAGATATATTTG - UNI33754 - TGCAACAGGACATTAGGAGTCTTCCCACAGATGACATTGCAG CTCTA

CCAATGGAAGAACAGTTGCGGAAACTCCAGGAGGAAAGAATGTGTAAAGTGTGTATGGACCGAGAGGTATCCATCGTGTTCATTCCCTGTGGCCATCTGG

TCGTGTGCAAAGACTGCGCTCCCTCTCTGAGGAAGTGTCCCATCTGTAGAGGGACCATCAAGGGCACAGTGCGCACATTTCTCTCCTGAACAAGACTAAT

GGTCCATGGCTGCAACTTCAGCCAGGAGGAAGTTCACTGTCACTCCCAGCTCCATTCGGAACTTGAGGCCAGCCTGGATAGCACGAGACACCGCCAAACA

CACAAATATAAACATGAAAAACTTTTGTCTGAAGTCAAGAATGAATGAATTACTTATATAATAATTTTAATTGGTTTCCTTAAAAGTGCTATTTGTTCCC

AACTCAGAAAATTGTTTTCTGTAAACATATTTACATACTACCTGCATCTAAAGTATTCATATATTCATATATTCAGATGTCATGAGAGAGGGTTTTGTTC

TTGTTCCTGAAAAGCAGGGATTGCCTGCACTCCTGAAATTCTCAGAAAGATTTACAATGTTGGCATTTATGGTTCAGAAACTAGAATCTTCTCCCGTTGC

TTTAAGAACCGGGAGCACAGATGTCCATGTGTTTTATGTATAGAAATTCCTGTTATTTATTGGATGACATTTTAGGGATATGAAATTTTTATAAAGAATT

TGTGAGAAAAAGTTAATAAAGCAACATAATTACCTCTTTTTTTTT
Translation
 - UNI33458 - - UNI36335 - MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGANDKVKCFCCGLML

DNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMSTMPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARL

LTYETWPLSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQSASRYTVSNLSMQTHAARIRTFSNWPSSALVHS

QELASAGFYYTG - UNI33458 - GHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPR RCEYLLRIKGQEFVSQVQAGYPHLLEQ LLSTSDSPEDE

NADAAI - UNI33754 - IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLLDAEDEMREEQMEQAAEEEES

D - UNI33754 - DDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECNAVKQKPHTLQASTLIDTVLAKGNTAATSFRNSLREIDPALYRDIFV

 - UNI33754 - VQQDIRSLPTDDIAA ALPMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTFLS

For any suggestions or comments, please send an email to unitrap@crg.es