Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032015 (Pou2f3)
Chromosomal location
Chr 9: 42932022 - 43013838 (-)
Description
POU domain, class 2, transcription factor 3 Gene [Source:MGI Symbol;Acc:MGI:102565]
RefSeq_dna
NM_011139 
RefSeq_peptide
NP_035269.2 
UniGene
Mm.436650 
MGI
MGI:102565 
Uniprot/SWISSPROT
P31362 
Uniprot/SPTREMBL
P70260 Q3U5D1 
Human Ortholog
ENSG00000137709 (POU2F3)
Omim not available
UniTrap UNI32752
Vector Insertion
Chr 9: 42984368 - 43007182
Public Clones (ggtc) IST14947F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034513
Sequence
CTTCCCCGGGGGCCAGGCTGGGGCAGCAGCGAGGGACCTGGGGGGGCGCAGGCTTTGGCCCCGCCTGGGGCAGGATGGTGAATCTGGAGCCCATGCACAC

AG - UNI32752 - AGATCAAGATGAGTGGGGATGTCGCTGATTCCACGGACACCCGCAGCACTTTCGGTCAAGTGGAGCCAG - UNI32752 - G

AAATGATCGAAATGGCCTAGATTTCAACAGACAG - UNI32752 - ATTAAGACGGAGGATCTGGGTGACTCTCTACAGCAGACCCTCTCCCACAGGC

CATGCCACCTGAGCCAAGGACCTACCATGATGCCTGGAAACCAAATGTCTGGG GACATGGCTTCTCTCCATCCACTCCAGCAGCTCGTGCTGGTCCCTG

GCCACTTGCAGTCTGTATCCCAGTTCCTGCTTTCCCAGACCCCACCTGGGCAGCAAG GTCTGCAGCCGAATCTTCTCTCCTTTCCACAGCAACAAAGCA

CTCTACTCCTCCCACAGACAGGGCCTGGCCTTGCCTCCCAG GCAGTTGGGCGCCCTGGGCTATCAGGATCCTCTTTAGAGCCCCACCTGGACGCTCCTC

AACACCTGCCAGGGCCCAAGCATCTGCCTGGCCCCGGAGGGAATGATGAGCCCACTGACCTGGAGGAGCTGGAGAAGTTCGCCAAGACCTTCAAGCAGAG

ACGCATTAAGCTAGGCTTCACACAG GGAGATGTGGGACTGGCGATGGGAAAGCTGTATGGCAATGACTTCAGCCAGACTACCATCTCGCGATTTGAGGC

CCTCAACCTGAGCTTCAAGAACATGTGCAAACTCAAGCCACTGCTGGAGAAGTGGTTGAATGATGCAG AGTCCTCCCCGTCAGACCCTTCAGCGAGCAC

ACCCAGCTCCTACCCCACTCTCAGCGAAGTGTTTGGCAGGAAGAGGAAGAAACGGACCAGCATCGAGACCAACATACGCCTGACTTTGGAGAAGCGATTT

CAAGAT AACCCGAAACCCAGCTCGGAAGAGATCTCCATGATTGCGGAGCAGTTATCGATGGAGAAGGAGGTGGTGAGAGTCTGGTTCTGCAATCGACGC

CAAAAGGAGAAGAGAATCAACTGCCCCGTGGCCACCCCTGTCAAACCACCCATCTACAACTCCCGGCTG GTCTCTCCCTCAGGGTCTCTGGGCCCCCTC

TCAGTCCCTCCTGTCCACAGCACCATGCCTGGAACAG TAACGTCATCCTGTTCCCCTGGGAACAACAGCAGGCCTTCGTCTCCTGGTTCAGGACTCCAT

GCCAGCAGCCCCACAGCATCTCAAAATAACTCCAAAGCAGCAATGAACTCCTCCTCCTCCTCCAGCTTTAACTCCTCGGG ATCATGGTACCGTTGGAAT

CATCCTACCTACCTCCACTGAGACCAAAAACTTCCTCCCTTTCCACCTGGCCCCTAGTTCCCAAAAGGAGGAAGAGAGTCGTGCCTTCCACATAGGGACA

GACACTTTGAGAAGAATGGGAGCAATGGCCACTGCTGAAGAGCAAACCCATAGTCTTGCCTTCTCCTGGATCCAGAGCTTTCGGAGAACCTAACTGTGAC

CAAAGGCCGCACTCTTGCCTTGGGCTCTTCATCACCCCGCTGGGAGTTTACTGTGTTCGCCTGCCTTGGGGCCCCCTCCATGCTCTCCTGGTGGCTTGAC

CTCTTGGAGAAAGGGCATTCTGCCATTGTTAGTTTTCAGCTCACCCATGGGCTTCTAGGACAGCCTTTTGCTCGGTGTGCCAAACTGCAAGAAGGGTAGA

TTATGGCTTTGACTCTGACCTCAGCCACAATCCCGAACAGATCCCAAATTCTATGGAAAGACTGAAATCTCACGTCTCCACCAAAGCCTTATCTTGTTAA

ATTAGCACAGTTTTCCCATGGAATCTCCATTTTTGCCCAATTTTCTTTCAGCCCTTACTCCCTTTTCTACAACCAAATCTGTCTATTCCTGGGTCCTACA

AAGTCCCTTCCTCTCTACAAATGGCTGAGCTACCCTCTGGCCATGTTGTTCCATCCACAGGTACTCCTCTGTTACCCACATGTACCCAAATTCCAGGACA

TTGTCTTTTCTCTGCTCCCTGTGGGTCTCCTTGTCCGGTCCCCTCTCCTTTCTCCTGGCCACAGAAAAGTGATGGCTGCGTTCTTGTACATAGTCCTTTC

CTATTCTGCACCATGACCTTTCTTTAATGTGTAATTTCCAGCAAGATGTTTAACTCAGGTGTGAACTTTGAAGATGTTTCTATATTATTTTATCTTCCAT

TAGAAAAGGAAGGGGGATACCAAAGTGTGTAATACCCCACAGAGTTCCCCCGTGAGCTGGGGTTCTGTTGACTTGGGGGGAACCTTATATGTGGAGTCTC

CTTCTGTGGATCTGTATGTAAAGCTGTCACATGAAAGCCATCCCAGAAATGGTACCTTTTTTTTTTTTTTTTTCCTAAAGACTGAATATCCAGGAAACTG

TTGAGACTCAAAGGAATCTCTCTGTTTCTAAATATATTTGTACAGCAATGACATAAAGTATTCCACTGTTAAT
Translation
MVNLEPMHTE - UNI32752 - EIKMSGDVADSTDTRSTFGQVEPG - UNI32752 - GNDRNGLDFNRQ - UNI32752 - IKTEDLGDSLQQ

TLSHRPCHLSQGPTMMPGNQMSG DMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQG GLQPNLLSFPQQQSTLLLPQTGPGLASQ AVGRPGLSGSS

LEPHLDAPQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQ GDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE 

ESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQD NPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSR

L VSPSGSLGPLSVPPVHSTMPGTV VTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNSSSSSSFNSSG GSWYRWNHPTYLH

For any suggestions or comments, please send an email to unitrap@crg.es