Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032017 (Grik4)
Chromosomal location
Chr 9: 42326218 - 42752576 (-)
Description
glutamate receptor, ionotropic, kainate 4 Gene [Source:MGI (curated);Acc:Grik4-001]
RefSeq_dna
NM_175481 
RefSeq_peptide
NP_780690.1 
UniGene
Mm.367909 Mm.370291 
MGI
MGI:95817 
Uniprot/SWISSPROT
Q8BMF5 
Uniprot/SPTREMBL
Q148R5 
Human Ortholog
ENSG00000149403 (GRIK4)
Omim not available
UniTrap UNI15215
Vector Insertion
Chr 9: 42626952 - 42752577
Public Clones (ggtc) PST9743-NR (escells) IST12243D8 (tigm)
Private Clones OST210171 (lexicon) OST182039 (lexicon) OST104318 (lexicon) OST65447 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24910
Vector Insertion
Chr 9: 42616721 - 42626952
Public Clones not available
Private Clones OST201328 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14655
Vector Insertion
Chr 9: 42496015 - 42616708
Public Clones FHCRC-GT-S3-11B1 (fhcrc) IST11219C8 (tigm) IST14295B3 (tigm) IST14980D7 (tigm)
IST14456H3 (tigm) IST11763A4 (tigm) IST10407A6 (tigm) IST14792C7 (tigm)
IST13692F12 (tigm) IST11286A8 (tigm) IST10261G7 (tigm) IST10174E3 (tigm)
IST14328C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114865
Sequence
AGACTCTGCCTTCGGCTGCTGGCGGATCGAGCTGGAGCCGCCGCCGCCGCCGCTGCGGAAGAAAAAAAAAAAAAGAAAAAAAAAAAAAAAAGGGAAAACA

ACAGCCGGGCCGCCGGCCGAGCAACGTCGGGTCCCCAGCTTGGCGCCCGGAGTGCGGAGCCGCCCAG - UNI15215 - ATACCGTGTGAGTACCTAC

TATGTGCCAGTCTGTGCCAGGCACTGGGGACACAGGTGGAAAAGTCCGAGTTGTTCCCTGCTTTTCTGGTTCTCATTGTCCCGGAG - UNI14655 - 

- UNI15215 - - UNI24910 - CGTTATGTCATGCCCAGACCAGCAGAGGGCTCCATGAGGAGTTATAGAAGATGCCCCGTGTCTCCGCTCCTCTG

GTGCTGCTTCCTGCTTGGCTCTTGATGGTGGCCTGTAGCCCACACTCCCTGAGGATTG - UNI14655 - CTGCTATCTTGGATGACCCCATGGAGTG

CAGCAGAGGGGAACGGCTCTCCATCACCCTGGCCAAGAACCGTATCAACCGCGCACCAGAGAGGCTGGGCAAGGCCAAGGTCGAAGTGGACATCTTTGAG

CTTCTCAGAGACAGCGAGTACGAAACTGCAGAAACCA - UNI14655 - TGTGTCAGATCCTCCCCAAGGGTGTGGTCGCTGTCCTGGGACCATCGTC

CAGCCCAGCCTCCAGCTCCATCATCAGCAACATCTGTGGAGAGAAGGAG GTCCCTCATTTCAAGGTGGCCCCAGAGGAATTTGTCAGGTTCCAACTCCA

GAGATTCACCACCCTGAACCTTCACCCCAGCAACACCGACATCAGCGTGGCTGTGGCTGGGATCCTGAACTTCTTCAACTGCACCACCGCCTGCCTCATC

TGTGCCAAAGCAGAAT GCCTTTTAAACCTGGAGAAGCTGCTCCGACAATTCCTTATCTCCAAGGACACACTCTCGGTCCGGATGTTGGACGACACACGG

GACCCCACTCCACTCCTCAAGGAGATCCGGGATGACAAGACAGCTACTATCATCATCCACGCCAACGCCTCCATGTCGCACACCATCCTCCTGAAG GCA

GCTGAACTGGGGATGGTGTCAGCCTATTACACATACATCTTCACCAATCTG GAGTTCTCCCTCCAGAGAATGGACAGCCTTGTGGATGATAGAGTCAAC

ATCTTAGGATTTTCCATTTTCAACCAATCCCATGCATTCTTCCAAGAGTTCTCCCAGAGCCTCAACCAATCCTGGCAGGAGAACTGTGACCATGTGCCCT

TCACCGGCCCTGCG TTGTCCTCAGCCCTGCTGTTTGACGCTGTCTATGCTGTGGTGACAGCGGTACAGGAACTGAACCGGAGCCAAGAGATTGGTGTGA

AGCCCCTGTCCTGTGGCTCAGCCCAGATCTGGCAGCATGGCACCAGCCTCATGAACTACCTTCGCATG GTAGAATTGGAAGGTCTTACCGGCCACATTG

AATTCAACAGCAAAGGCCAGAGGTCCAACTATGCCTTGAAAATCTTACAGTTCACCAGGAATGGGTTTCAGCAG ATTGGCCAGTGGCATGTGGCAGAGG

GCCTCAGCATGGACAGCCGCCTCTACGCCTCCAACATCTCTGACAGTCTCTTCAACACCACCCTGGTCGTCACCACCATCCTG GAAAACCCATACTTAA

TGCTGAAGGGGAACCACCAGGAGATGGAAGGCAATGACCGATATGAGGGATTCTGTGTGGACATGCTCAAGGAGTTGGCTGAGATCCTACGGTTCAACTA

CAAGATCCGCCTTGTTGGGGATGGTGTTTACGGCGTACCTGAGGCCAACGGCACCTGGACAGGCATGGTTGGGGAGCTGATCGCTCGG AAAGCGGATCT

GGCTGTGGCGGGCCTCACCATCACAGCGGAACGTGAGAAAGTGATCGATTTCTCCAAGCCATTCATGACGCTGGGAATTAGTATTCTTTACAGAGTTCAT

ATG GGACGCAGACCGGGCTATTTCTCCTTCCTGGATCCCTTTTCTCCAGGAGTCTGGCTCTTCATGCTTCTAGCTTATCTGGCGGTCAGCTGTGTCCTC

TTCCTGGTGGCTCG GTTGACTCCTTATGAGTGGTACAGTCCACATCCTTGTGCGCAGGGCCGGTGTAATCTCCTGGTCAACCAGTACTCCCTGGGCAAC

AGCCTCTGGTTTCCGGTTGGAGGCTTCATGCAGCAAGGCTCCACTATTGCCCCTCGAGCTTTGTCTACCCGCTGTGTCAGTGGTGTCTG GTGGGCATTC

ACGTTGATCATCATCTCCTCCTACACGGCCAACCTGGCAGCCTTCCTGACTGTGCAGCGCATGGAGGTGCCCATTGAGTCTGTGGATGACCTGGCTGACC

AGACTGCCATTGAGTATGGCACGATTCATGGAGGCTCCAGCATGACCTTCTTCCAA AATTCCCGTTACCAGACCTACCAACGCATGTGGAACTACATGT

ACTCCAAGCAGCCGAGTGTGTTCGTGAAGAGCACGGAGGAGGGGATTGCCAGAGTGTTGAATTCCAATTACGCCTTCCTGCTGGAGTCTACCATGAATGA

GTACTACCGGCAGCGAAACTGCAACCTCACTCAGATTGGGGGCCTGCTGGACACCAAGGGCTATGGGATTGGCATGCCAGTCG GCTCAGTGTTCCGGGA

TGAGTTCGACCTGGCCATTCTCCAGCTGCAGGAGAACAACCGCCTGGAAATTCTGAAGCGGAAGTGGTGGGAAGGGGGAAAATGTCCCAAGGAGGAGGAC

CATCGAGCCAAAG GCCTGGGAATGGAGAATATTGGTGGAATCTTTGTGGTTCTTATTTGTGGCTTAATAGTGGCCATTTTTATGGCTATGCTGGAGTTT

TTGTGGACTCTCAGACACTCAGAAGCATCAGAG GTGTCTGTGTGTCAGGAGATGGTGACAGAACTGCGCAACATCATCCTGTGCCAGGACAATATCCAT

CCCAGGCGGCGGCGCTCTGGAGGCCTGCCACCCCAGCCCCCGGTCCTGGAGGAGCGCCGACCCAGAGGCACAGCGACGCTCAGCAATGGCAAGCTATGTG

GCGCCGGGGAGCCAGACCAGCTGGCGCAGAGACTGGCACAGGAGGCCGCCCTAGTAGCTCGAGGCTGCACGCACATCCGCGTGTGCCCAGAGTGCCGCCG

CTTCCAGGGCCTGCGGGCGCGACCGTCGCCAGCGCGCAGCGAGGAGAGCCTGGAGTGGGACAAGACCACCAACAGCAGCGAGCCCGAGTAGTGGCAGCAG

CGAAGGACCATGGAGCCAGGCGGGGAGGCGGGAGGGCTAACATTACAAGTTCCTTCTCTCCGGATTCAAGATTCAATGACTTTACAAAGCGATCTGAGCC

TGCTGCCCCAGCAGGAGGCGGATCTCCCTGCCCTGTGGCAGAGCGGCCTATCCGAGATGAGACACTGCACCCACGTGGCAGAGACGCTGTCCCTCGTGGG

CACAAGGACCCATCTCCTCCCAGAGAGCCTTTCCCTCACACTCAAATAAGTGGATTCTGGGTTGTGGGGCCCTGCCGAGAGAGCAGTCCAAGAATTGATG

GTGTCATCAGTTGAATTCCCCCTAGGAAGGGGCCATTGTACCCTGGGTCTAGTTCTTACAGGAAAAAAAAATTAAACTCAACAGGGAAGTTTTCTTTTCT

GAATTTGTATATTTTTGTTGATGTCCTTTTCTTTCCTCTCATGGTTTTTTTTTTTTTCTTTTTTCTTTTTCTTTCCTGTCTCTTCTGGGTTCTGTTCTAA

GGCTCCCTTGTCTTGTGCTTGGGGATGGAAGTCTGACCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCCCCCTTAGGTTT

TGGAGTTGCAGGTGCACTGGGTTTCAGGTGCTGACTCCCCCCCCCTCCTCCCCCCCCCCCCCCAGTGACTGGTGTTTGGTAGTCTCCCTCTGCATAGAGA

GAGGGTGAAAGTCCATCAAACAAACTTTTTAAATGCAACATACAAGCAAACAAACAGGAATGTAACCTTCCTGGAGATACTTTGAAATTCCCGGGGCTCT

AAGGATTAATCTGGTTTTTCTTTTTCTTTACCCTTTTCATCTCTGAAAACAGAAGGAAGAAAGAATCTTTAAAGCATGCAGAGTATTGTATAAGGAGAAG

GAGATGTGTATGCGTGTGTGATTTCCCCACACCTTGGTGGTCCTGACTTCCATTGCAAGGCACTACTCAGAGAAGTGAGAGACAGGGCGCCCAACGGGTA

TGATAGACTCTTCAACTGGATCTGCTTTTAGCTGAAGTTGGTAGTAAGTTGCCTCTGAAGCCCTACCCACAAGGCTCTTATGTATTGGGTCACTTTTTGG

TACTAGACATGAAACCTGGATGCAACTGTGTGTGTGTGTGTGTATGCGTGTGTGCATGTGTGCACACGCTCGCGTGCCTGCGTGTGTGTGTGTGCATGCA

TGTGTGTGTGTGTGTGCATGTGTGTGTGTGTGTGTATGCTCCTATACATGTGAGAACCTAAGCATATATGCATGTGTTTATGAAACAGACCGCAAATAGC

CAACAACCTAGTTCCTGGAAGAGAGTGGAGGGTTTTAGCCCACCAGCGGCCGAAGAACTAGGAACCGGAACCATGAGTTCAGATCTCCGTGTGGTCAGTA

GTTTTCCTTGTGTGACTCAGAGTGAATTGTTTGACCTCTCTGCTGCAGCCTGGGAGTCAGCAATACTTTCCTAGGGTATCTCGGACCGGACCGATCTGCC

CTGCCAGTAGGAGGCTTGCAAGGTCTGATGGGAATACCCTCTCAATGGGAGGGCCAAGGCTCCCAAGGAGCCACTTGGCCTTGGTTTGGTCTCACCACTT

CAGAATTCCATGAAGAGCTGTCATTTTCGGATGGAAAGCAAATTCTATGCAATTTCTGATAGTAACTTAGAAAACTCGGAGACTGGGTGGGGGTGGGGGA

GGAGACAGCTGCCACCAACTCCCACCTCCTGCACCTCCACCTTGAGCTGAGCTGATTTCACGTGGCTCCTGTTCTGAATGTCCTAAAATAAAGACTTTTT

TTTTTTTAAAGATGGGCTGAATCCCCTGGTGCCGCCTTTTGTGTAAGTTGGCATCCTGTCTGTGCCAGGATAGTTTGTTAGAGCTGCCACCCCGGGGCCC

AAGTTGTAACCCTAATTCTTCTGGGTCCATATAAGAGATGCCCTGCTGGTCCTAAACTGACCCCTTGCTGGTAACTCTGAAGCCTTTTTTCATTTTTCTC

TATAACTGCCCAGTGGCAGCAAATTTTGTGGGACACTTAAGTTTTGTTTTGTTTTGTTTTTCTTTTTGGTTTTGGTTTTTTGCCATTCCTTGTGGAAAAA

TACAGATTTGGTGGGAAGGACATTTGAAAGCTGACTGCCAGCAGTTCCCCCTCCCACCTCACCCCACCCCTCTGCCATGGTGTCACAACTGATACACCCC

ACCACCACACCCCAGCCCTTTCTCATGCTTCTGACTCCAGGATCCCTCCTACCAGATCACATCTTGGACAGGAAGGTTTGTTTTTTAAACTCGTTTTTAT

GAGCAGGATATCTTGATCAATAGAAACTTTTTTTAATGGATTAGTCAAGTAAATGTTCCCACGCATCATTTGTGATGTCTGTTTCCCATCCCTGCGTGGA

GTAAGGAGGAGACTGACAGCATCAGGCAGCTTTCTTTAACTCCCGGACCGTCTCTGCGCCTTCCTCCAGTTGCTACGTGCGTCTAGTTGCTAAGCGCGTG

CGTGAATCTGCTACCAGCTGTTTCTGGACCTTGGTTTGTCTCCACATTTCATTCATGGGTCGTTGGCCTTCTTTCGCATCCTGTGTTTTCTATCTGACTC

TGTGTACTATATAAAGCAGTTTTTTCTTGTCTGTTTACCTTTCTTCGACTGGAATATTTACAATAAAACAAACCCTGAAATGTTA
Translation
 - UNI15215 -  - UNI14655 - - UNI15215 - - UNI24910 - MPRVSAPLVLLPAWLLMVACSPHSLRIA - UNI14655 - AAIL

DDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETM - UNI14655 - MCQILPKGVVAVLGPSSSPASSSIISNICGEKE 

VPHFKVAPEEFVRFQLQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAEC CLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTA

TIIIHANASMSHTILLK AAELGMVSAYYTYIFTNL EFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFSQSLNQSWQENCDHVPFTGPA LSSALLFD

AVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRM VELEGLTGHIEFNSKGQRSNYALKILQFTRNGFQQ IGQWHVAEGLSMDSRLYASN

ISDSLFNTTLVVTTIL ENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGELIAR KADLAVAGLTITAE

REKVIDFSKPFMTLGISILYRVHM GRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVAR RLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGG

FMQQGSTIAPRALSTRCVSGVW WWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTIHGGSSMTFFQ NSRYQTYQRMWNYMYSKQPS

VFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVG GSVFRDEFDLAILQLQENNRLEILKRKWWEGGKCPKEEDHRAK

G GLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEASE VSVCQEMVTELRNIILCQDNIHPRRRRSGGLPPQPPVLEERRPRGTATLSNGKLCGA

GEPDQLAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWDKTTNSSEPE
Transcript ENSMUST00000034515
Sequence
TGTCCCCTCACAGCGTTATGTCATGCCCAGACCAGCAGAGGGCTCCATGAGGAGTTATAGAAGATGCCCCGTGTCTCCGCTCCTCTGGTGCTGCTTCCTG

CTTGGCTCTTGATGGTGGCCTGTAGCCCACACTCCCTGAGGATTG - UNI14655 - CTGCTATCTTGGATGACCCCATGGAGTGCAGCAGAGGGGAA

CGGCTCTCCATCACCCTGGCCAAGAACCGTATCAACCGCGCACCAGAGAGGCTGGGCAAGGCCAAGGTCGAAGTGGACATCTTTGAGCTTCTCAGAGACA

GCGAGTACGAAACTGCAGAAACCA - UNI14655 - TGTGTCAGATCCTCCCCAAGGGTGTGGTCGCTGTCCTGGGACCATCGTCCAGCCCAGCCTCC

AGCTCCATCATCAGCAACATCTGTGGAGAGAAGGAG GTCCCTCATTTCAAGGTGGCCCCAGAGGAATTTGTCAGGTTCCAACTCCAGAGATTCACCACC

CTGAACCTTCACCCCAGCAACACCGACATCAGCGTGGCTGTGGCTGGGATCCTGAACTTCTTCAACTGCACCACCGCCTGCCTCATCTGTGCCAAAGCAG

AAT GCCTTTTAAACCTGGAGAAGCTGCTCCGACAATTCCTTATCTCCAAGGACACACTCTCGGTCCGGATGTTGGACGACACACGGGACCCCACTCCAC

TCCTCAAGGAGATCCGGGATGACAAGACAGCTACTATCATCATCCACGCCAACGCCTCCATGTCGCACACCATCCTCCTGAAG GCAGCTGAACTGGGGA

TGGTGTCAGCCTATTACACATACATCTTCACCAATCTG GAGTTCTCCCTCCAGAGAATGGACAGCCTTGTGGATGATAGAGTCAACATCTTAGGATTTT

CCATTTTCAACCAATCCCATGCATTCTTCCAAGAGTTCTCCCAGAGCCTCAACCAATCCTGGCAGGAGAACTGTGACCATGTGCCCTTCACCGGCCCTGC

G TTGTCCTCAGCCCTGCTGTTTGACGCTGTCTATGCTGTGGTGACAGCGGTACAGGAACTGAACCGGAGCCAAGAGATTGGTGTGAAGCCCCTGTCCTG

TGGCTCAGCCCAGATCTGGCAGCATGGCACCAGCCTCATGAACTACCTTCGCATG GTAGAATTGGAAGGTCTTACCGGCCACATTGAATTCAACAGCAA

AGGCCAGAGGTCCAACTATGCCTTGAAAATCTTACAGTTCACCAGGAATGGGTTTCAGCAG ATTGGCCAGTGGCATGTGGCAGAGGGCCTCAGCATGGA

CAGCCGCCTCTACGCCTCCAACATCTCTGACAGTCTCTTCAACACCACCCTGGTCGTCACCACCATCCTG GAAAACCCATACTTAATGCTGAAGGGGAA

CCACCAGGAGATGGAAGGCAATGACCGATATGAGGGATTCTGTGTGGACATGCTCAAGGAGTTGGCTGAGATCCTACGGTTCAACTACAAGATCCGCCTT

GTTGGGGATGGTGTTTACGGCGTACCTGAGGCCAACGGCACCTGGACAGGCATGGTTGGGGAGCTGATCGCTCGG AAAGCGGATCTGGCTGTGGCGGGC

CTCACCATCACAGCGGAACGTGAGAAAGTGATCGATTTCTCCAAGCCATTCATGACGCTGGGAATTAGTATTCTTTACAGAGTTCATATG GGACGCAGA

CCGGGCTATTTCTCCTTCCTGGATCCCTTTTCTCCAGGAGTCTGGCTCTTCATGCTTCTAGCTTATCTGGCGGTCAGCTGTGTCCTCTTCCTGGTGGCTC

G GTTGACTCCTTATGAGTGGTACAGTCCACATCCTTGTGCGCAGGGCCGGTGTAATCTCCTGGTCAACCAGTACTCCCTGGGCAACAGCCTCTGGTTTC

CGGTTGGAGGCTTCATGCAGCAAGGCTCCACTATTGCCCCTCGAGCTTTGTCTACCCGCTGTGTCAGTGGTGTCTG GTGGGCATTCACGTTGATCATCA

TCTCCTCCTACACGGCCAACCTGGCAGCCTTCCTGACTGTGCAGCGCATGGAGGTGCCCATTGAGTCTGTGGATGACCTGGCTGACCAGACTGCCATTGA

GTATGGCACGATTCATGGAGGCTCCAGCATGACCTTCTTCCAA AATTCCCGTTACCAGACCTACCAACGCATGTGGAACTACATGTACTCCAAGCAGCC

GAGTGTGTTCGTGAAGAGCACGGAGGAGGGGATTGCCAGAGTGTTGAATTCCAATTACGCCTTCCTGCTGGAGTCTACCATGAATGAGTACTACCGGCAG

CGAAACTGCAACCTCACTCAGATTGGGGGCCTGCTGGACACCAAGGGCTATGGGATTGGCATGCCAGTCG GCTCAGTGTTCCGGGATGAGTTCGACCTG

GCCATTCTCCAGCTGCAGGAGAACAACCGCCTGGAAATTCTGAAGCGGAAGTGGTGGGAAGGGGGAAAATGTCCCAAGGAGGAGGACCATCGAGCCAAAG

 GCCTGGGAATGGAGAATATTGGTGGAATCTTTGTGGTTCTTATTTGTGGCTTAATAGTGGCCATTTTTATGGCTATGCTGGAGTTTTTGTGGACTCTCA

GACACTCAGAAGCATCAGAG GTGTCTGTGTGTCAGGAGATGGTGACAGAACTGCGCAACATCATCCTGTGCCAGGACAATATCCATCCCAGGCGGCGGC

GCTCTGGAGGCCTGCCACCCCAGCCCCCGGTCCTGGAGGAGCGCCGACCCAGAGGCACAGCGACGCTCAGCAATGGCAAGCTATGTGGCGCCGGGGAGCC

AGACCAGCTGGCGCAGAGACTGGCACAGGAGGCCGCCCTAGTAGCTCGAGGCTGCACGCACATCCGCGTGTGCCCAGAGTGCCGCCGCTTCCAGGGCCTG

CGGGCGCGACCGTCGCCAGCGCGCAGCGAGGAGAGCCTGGAGTGGGACAAGACCACCAACAGCAGCGAGCCCGAGTAGTGGCAGCAGCGAAGGACCATGG

AGCCAGGCGGGGAGGCGGGAGGGCTAACATTACAAGTTCCTTCTCTCCGGATTCAAGATTCAATGACTTTACAAAGCGATCTGAGCCTGCTGCCCCAGCA

GGAGGCGGATCTCCCTGCCCTGTGGCAGAGCGGCCTATCCGAGATGAGACACTGCACCCACGTGGCAGAGACGCTGTCCCTCGTGGGCACAAGGACCCAT

CTCCTCCCAGAGAGCCTTTCCCTCACACTCAAATAAGTGGATTCTGGGTTGTGGGGCCCTGCCGAGAGAGCAGTCCAAGAATTGATGGTGTCATCAGTTG

AATTCCCCCTAGGAAGGGGCCATTGTACCCTGGGTCTAGTTCTTACAGGAAAAAAAAATTAAACTCAACAGGGAAGTTTTCTTTTCTGAATTTGT
Translation
MPRVSAPLVLLPAWLLMVACSPHSLRIA - UNI14655 - AAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETM -

 UNI14655 - MCQILPKGVVAVLGPSSSPASSSIISNICGEKE VPHFKVAPEEFVRFQLQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKA

EC CLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLK AAELGMVSAYYTYIFTNL EFSLQRMDSLVDDRVNI

LGFSIFNQSHAFFQEFSQSLNQSWQENCDHVPFTGPA LSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRM VELEGLTGHI

EFNSKGQRSNYALKILQFTRNGFQQ IGQWHVAEGLSMDSRLYASNISDSLFNTTLVVTTIL ENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRF

NYKIRLVGDGVYGVPEANGTWTGMVGELIAR KADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHM GRRPGYFSFLDPFSPGVWLFMLLAYLAVS

CVLFLVAR RLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGVW WWAFTLIIISSYTANLAAFLTVQRMEVPIES

VDDLADQTAIEYGTIHGGSSMTFFQ NSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMP

VG GSVFRDEFDLAILQLQENNRLEILKRKWWEGGKCPKEEDHRAKG GLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEASE VSVCQEMVTEL

RNIILCQDNIHPRRRRSGGLPPQPPVLEERRPRGTATLSNGKLCGAGEPDQLAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWDKT

TNSSEPE

For any suggestions or comments, please send an email to unitrap@crg.es