Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032020 (Ubash3b)
Chromosomal location
Chr 9: 40821709 - 40965798 (-)
Description
ubiquitin associated and SH3 domain containing, B Gene [Source:MGI Symbol;Acc:MGI:1920078]
RefSeq_dna
NM_176860 
RefSeq_peptide
NP_789830.1 
UniGene
Mm.133615 
MGI
MGI:1920078 
Uniprot/SWISSPROT
Q8BGG7 
Human Ortholog
not available
Omim not available
UniTrap UNI34427
Vector Insertion
Chr 9: 40859399 - 40965799
Public Clones IST14309G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044155
Sequence
ACTCATTGCAAATTCCCGGACAGCTCGGGGAGGAGAAGCTGGTGGGGCGGAGGACAGAGAAGGCTGCAGCGGCGCAACGCTGGGACTCCGGGACCCCGCG

GGCTGAGGTCGGACCCGCAGCAGCCACCGGCCCGCGCCGAGCTCCAGTGGCCTCTCCAGGAAGCGTCAGTCTCCGCCCGGAGATCTGGGAGCACCGCCCC

CACCGTCCTCCCCGGACCCCCAGTCCCCGGCGCGCGGGCGATGGGCGGCCACTGAGCGGGCACTCGGCACCGCGACCCCAGCCCTCGGCATGGCCGCGCG

CGAGGAGCTGTACAGCAAAGTCACCCCGCGCAGGGACCGCCTGCAGCGCCCGGGCACAGTCAAGCATGGGTCGGCGCTGGACGTGCTCCTGTCCATGGGC

TTTCCCCGCGCCCGCGC - UNI34427 - ACAAAAAGCTCTGGCATCCACGGGAGGAAGAAGCGTTCAGGCAGCATGTGACTG - UNI34427 - G

TTGTTCTCCCATGTGGGTGACCCCTTCCTGGATGACCCCCTGCCTCGGGAGTATGTCCTCTACCTCCGCCCGACAGGGCCATTAGCCCAGAAGCTCTCTG

ACTTCTGGCAGCAGTCCAAGCAGATCTGCGGGAAGAACAAGGCCCACAACATCTTCCCCCACATCACTCTCTGCCAGTTCTTCATG TGCGAGGACAGCA

AGGTGGATGCTCTGGGGGAAGCCCTGCAGACTACTGTCAGTCGATGGAAATGTAAGTTCTCAGCCCCACTGCCCCTGGAGCTGTACACCTCCTCCAACTT

CATCGGGCTCTTCGTGAAGGAAGACAGCGCTGAAGTCCTCAAGAAGTTCGCGGCTGACTTTGCTGCAGAGGCTGCATCCAAAACAG AAGTGCACGTGGA

GCCTCATAAGAAGCAGCTGCATGTGACGCTGGCCTACCACTTCCAAGCCAGCCACCTACCCACCCTAGAGAAGCTTGCCCAGAACATTGACGTCAAGCTA

GGATGCGACTGGGTGGCCACCATATTCTCTCGGGATATCCGGTTTGCTAACCATGAG ACGTTACAGGTGATCTATCCCTATTCACCTCAGAATGATGAC

GAGCTGGAGCTGGTCCCAGGGGACTTCATCTTCATGTCTCCCATGGAACAGACCAGCACCAGTGAGGGCTGGATTTATGGCACCTCGCTGACCACTGGCT

GCTCTGGGCTGCTTCCTGAGAACTACATCACCAAGGCTGATGAGTGTAGCACCTGGATCTTCCATGG TTCCTACTCCATCCTAAATACCGTATCATCCA

GCTCACTCGCGTTTGGCGATGGAGCGTTAGAGAGGCGGCAGTATGAAGATCAAGGACTTGGGGAGACAACACCCCTCACTATCATCTGCCAGCCCATGCA

G CCCCTGAGAGTCAACAGCCAGCCTGGACCCCAGAAGCGATGCCTCTTTGTATGTCGGCATGGGGAGAGGATGGACGTTGTATTTGGGAAGTACTGGCT

GTCCCAATGCTTTGATGCCAAAG GCCGCTACATACGCACCAACCTGAACATGCCTCACAGTTTACCTCAGAGGAGCGGCGGTTTCCGGGATTACGAGAA

AGATGCTCCAATCACTGTGTTTGGGTGTATGCAAGCAAGACTAGTGG GTGAAGCCTTGTTAGAAAGTAATACTGTTATTGATCACGTGTATTGCTCACC

ATCCCTCCGCTGCGTTCAGACTGCACATAATATTTTGAAAG GTTTACAACAAGACAATCACTTGAAGATTCGAGTGGAGCCGGGCTTATTTGAATGGAC

AAAGTGGGTTGCTGGGAGCACATTACCGGCATGGATACCTCCATCAGAGTTAGCTGCAGCCAACCTGAGTGTTGATACAACCTACAG ACCTCACATTCC

AGTCAGCAAATTGGCGATTTCGGAATCCTATGACACCTACATCAATAGGAGTTTCCAGGTGACGAAAGAGATAATAAGTGAATGCAAAAGTAAAG GAAA

TAACATTCTGATTGTGGCCCACGCATCTTCCCTCGAAGCGTGTACCTGTCAGCTCCAAGGTCTATCCCCGCAGAACTCAAAGGACTTCGTACAAATGGTC

CGGAAG ATCCCATACCTAGGCTTCTGTTCCTGCGAAGAATTGGGAGAAACTGGAATATGGCAACTGACAGACCCGCCCATCCTTCCCCTTACCCATGGC

CCCACTGGGGGCTTCAACTGGAGAGAGACCCTCCTGCAAGAATAAGCTGCCTGAGAGCTGGGAAGAACTGGCCTTTTGCAGATGAGTCCTCAGGATGCCC

TGTAGCAGTGGGAAAGCCCACGCTGCATTCAAAGCAGACAGCTCAGAATCATTTAGCATATTTCTTTTCATGCTTAGGGGACGGTGAGATTGTGAGAGAA

AGTCGTGATTCAGAGGGGAAATTAAAAAAAAAAAAAAAACAATCCATCTCTCTGGACTTGCCTAGCTACCAAGGCTTTGGAGAAGTGTCTTCCTAGGCTG

AGCACCTGATGCAGCAGAAACTACCATCCTCCTTCAGGCTATGCATGGCTAAAGAGCCTCATTCTTCTCCCAGAGAGCTGCTCCCTCCCGGAGAGGCATG

CAAGAGGAAGGACTGTGTCTGGAATCCAACTGGGGAGAGGATAGTCTTTTTGTACTCCATTTGCAAGTTAGGGAAAGCCACACTGAGGAGTGCTTTGATG

GTTGTTAGGGACCGTAAGAATAGTCCTGTGTCAGACAGCAGATTCTACCCTCAGCAGACTCCATTCACTGCCGCTGTGAGGCACCCACTTGAGGTCTCCC

GACATTCACCCTGGTACCACACCACTTGATCTCCAGAGCAATCTGGCCCTTCATGCTTCTATCTGTGAAATGGGGAGAACAGCCCTTTGCACGTTGAGAT

ACTCAGGAGGGATCAAGAGAACGAGTGATGTGTGTTGAATGGGAGGTGGAGCTACTTGCAGAATTTTAACCAAGTTGAAATTACCCCTGTGATGGCCGGA

TGAACTGTGAAGTCCCCAAGCCTGCCTGAATCAGGACGTGTCTTTCCACCCAGACTCTAGACTGTGTTAAGCAGTTAAGGAGATTGACATTTGAAAGGAT

GTTATGTTGGATTCACTATTTGGATCAGCAAAAAACAAAAACAGAAAACAAAAACACAAAAAGAAAAAAAAAAACCTCCAGTGCAATACAGATATTTTTA

GAAACTATACCGAGGGTCGTGTTGTTGGTCACATACAGGCCATGTCCACTGTAGCAGAATGTCCATAGGTTAGCCCATTTTAGGTTGTCCAGGAAGCCCA

GGGACTAACGTGAATGGTGACAGTCACAACTGCACTGCTTCTTTTGCTGCCCTCTTTGCTTTTCTATGGTAATTTAGAACAGACGGGAGGGAGGACCACT

TGAAGGAAGCTGGAGAGTCAGAGCCTATCTGTGGGCTCTCACTGCACCTACTTCCTGTACTTAGAGAGAGTGTGTGTATTTAAAAGAAGAATAAATGACA

ATCAAACCAAAACATCCC
Translation
MAAREELYSKVTPRRDRLQRPGTVKHGSALDVLLSMGFPRARA - UNI34427 - AQKALASTGGRSVQAACDW - UNI34427 - WLFSHVGDPF

LDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFM CEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED

SAEVLKKFAADFAAEAASKTE EVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRDIRFANHE TLQVIYPYSPQNDDELELVP

GDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHG GSYSILNTVSSSSLAFGDGALERRQYEDQGLGETTPLTIICQPMQ PLR

VNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKG GRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVG GEALLESNTVIDHVYCSP

SLRCVQTAHNILKG GLQQDNHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYR RPHIPVSKLAISESYDTYINRSFQVTKEIISECKS

KG GNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRK IPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

For any suggestions or comments, please send an email to unitrap@crg.es