Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032036 (Kirrel3)
Chromosomal location
Chr 9: 34296689 - 34844301 (+)
Description
kin of IRRE like 3 (Drosophila) Gene [Source:MGI (curated);Acc:Kirrel3-001]
RefSeq_dna
NM_026324 
RefSeq_peptide
NP_080600.1 
MGI
MGI:1914953 
Uniprot/SWISSPROT
Q8BR86 
Uniprot/SPTREMBL
Q80T80 Q3TAG1 
Human Ortholog
ENSG00000149571 (KIRREL3)
Omim not available
UniTrap UNI38473
Vector Insertion
Chr 9: 34296744 - 34712497
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32975
Vector Insertion
Chr 9: 34752105 - 34798519
Public Clones IST10041D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16289
Vector Insertion
Chr 9: 34798519 - 34798678
Public Clones not available
Private Clones OST464040 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115143
Sequence
TTTTTCTTGTTTCCAGGACTTCTAAGCCTGTGAAGGATCTTTCCAACTCCCTTCAACTTTTCCAGCTCATTTGTCTTATGCCTCCATGCTGACCTGATGG

CTCACCACATGTATTTG AGCTTGGCCTCCAGAAGAGAGGATGCTGTCTGGTACTGGGCTACATGGCCAAGGACAAGTTTCGGAGAATGAATGAAG GTC

AAGTCTACTCCTTCAGCCAGCAACCCCAGGACCAAGTGGTGGTGTCAGGACAGCCAGTGACTCTGCTGTGTGCCATCCCTGAATATGATGGCTTCGTCCT

GTGGATCAAAGATGGCTTGGCTCTGGGTGTAGGCAGAGACCTCTCAA GTTACCCCCAGTACCTGGTGGTGGGGAACCACCTCTCAGGAGAGCATCACCT

GAAGATCCTGAGGGCTGAGCTTCAGGATGATGCCGTGTATGAGTGCCAGGCCATCCAGGCTGCCATCCGGTCCCGCCCTGCACGCCTCACCGTCCTGG -

 UNI16289 - - UNI32975 - TGCCACCAGATGACCCCATCATCCTAGGGGGGCCTGTGATCAGCCTTCGGGCAGGGGACCCCCTCAACCTCACCT

GCCACGCAGACAATGCCAAGCCTGCGGCTTCCATCATCTGGCTACGTAAAGGAGAGGTCATCAATGGAGCCACCTACTCCAAGGTGAGCCTGAGGGAGAG

AATGGGGGTGCAGGATGGAGAGTGA
Translation
 MAKDKFRRMNEG GQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSS SYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQ

AIQAAIRSRPARLTVLV - UNI16289 - - UNI32975 - VPPDDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKVSL

RERMGVQDGE
Transcript ENSMUST00000045091
Sequence
TCTTGTTTCCAGGACTTCTAAGCCTGTGAAGGATCTTTCCAACTCCCTTCAACTTTTCCAGCTCATTTGTCTTATGCCTCCATGCTGACCTGATGGCTCA

CCACATGTATTTG AGCTTGGCCTCCAGAAGAGAGGATGCTGTCTGGTACTGGGCTACATGGCCAAGGACAAGTTTCGGAGAATGAATGAAG GTCAAGT

CTACTCCTTCAGCCAGCAACCCCAGGACCAAGTGGTGGTGTCAGGACAGCCAGTGACTCTGCTGTGTGCCATCCCTGAATATGATGGCTTCGTCCTGTGG

ATCAAAGATGGCTTGGCTCTGGGTGTAGGCAGAGACCTCTCAA GTTACCCCCAGTACCTGGTGGTGGGGAACCACCTCTCAGGAGAGCATCACCTGAAG

ATCCTGAGGGCTGAGCTTCAGGATGATGCCGTGTATGAGTGCCAGGCCATCCAGGCTGCCATCCGGTCCCGCCCTGCACGCCTCACCGTCCTGG - UNI

16289 - - UNI32975 - TGCCACCAGATGACCCCATCATCCTAGGGGGGCCTGTGATCAGCCTTCGGGCAGGGGACCCCCTCAACCTCACCTGCCA

CGCAGACAATGCCAAGCCTGCGGCTTCCATCATCTGGCTACGTAAAGGAGAGGTCATCAATGGAGCCACCTACTCCAAG - UNI16289 - ACCCTGC

TTCGAGACGGCAAACGAGAAAGCATTGTCAGCACCCTCTTCATCTCCCCAGGAGACGTGGAAAATGGACAGAGTATTGTGTGCCGAGCCACCAACAAAGC

CATCCCCGGAGGAAAAGAGACCTCTGTCACCATAGACATCCAGC ATCCACCGCTTGTCAACTTGTCCGTGGAACCACAGCCGGTATTGGAGGACAACAT

CGTCACGTTCCACTGCTCTGCAAAGGCCAACCCAGCTGTCACCCAGTACAG GTGGGCCAAACGGGGTCACATCATCAAGGAGGCATCTGGGGAGCTGTA

TAGGACCACGGTGGACTACACATACTTCTCAGAGCCTGTATCCTGTGAAGTAACCAATGCCCTGGGCAGCACCAACCTCAGCCGCACAGTGGATGTATAC

T TCGGTCCTCGAATGACCTCAGAGCCTCAGTCACTGCTGGTAGATCTGGGCTCCGATGCTGTCTTCAGCTGTGCGTGGATCGGCAACCCGTCTCTGACC

ATCGTGTGGATGAAACGAGGTTCTGGTGTG GTCCTGAGCAATGAAAAGACCCTAACCCTCAAATCTGTCCGCCAAGAGGATGCTGGGAAGTACGTGTGC

CGGGCTGTGGTGCCCCGGGTAGGAGCTGGGGAGAGAGAGGTGACCTTGACTGTCAATG GACCCCCCATCATCTCCAGCACACAGACCCAGCACGCCCTC

CACGGAGAGAAGGGCCAGATCAAATGCTTCATCCGGAGCACACCACCGCCTGACCGAATT GCCTGGTCCTGGAAGGAGAATGTGCTGGAGTCAGGGACA

TCAGGGCGCTACACAGTGGAGACGGTGAACACGGAGGAGGGAGTCATCTCCACATTGACCATTAGCAACATTGTGCGTGCTGACTTCCAGACCATATACA

ACTGTACAGCCTGGAACAGCTTTGGCTCTGACACAGAGATCATCCGACTCAAGGAACAAG AGTCTGTACCAATGGCCGTCATCATCGGGGTGGCCGTAG

GAGCTGGCGTGGCCTTCCTCGTCCTAATGGCAACCATTGTGGCCTTCTGCTGTGCCCGTTCCCAGAGAA ATCTCAAAGGTGTTGTATCAGCCAAAAATG

ATATTCGAGTGGAAATTGTGCACAAGGAGCCATCTTCTGGCCGGGAGGCTGAGGACCACACCACCATAAAGCAGCTGATG ATGGACCGGGGTGAATTCC

AACAAGACTCGGTGCTGAAACAGCTGGAGGTCCTCAAAGAAGAGGAGAAGGAGTTTCAGAACCTGAAG GACCCCACCAACGGCTACTACAGCGTCAACA

CCTTCAAAGAACACCATTCAACTCCAACCATCTCCCTGTCCAGCTGCCAGCCAGACCTGCGTCCGACAGGCAAACAGCGTGTGCCCACAGGCATGTCCTT

CACCAACATCTACAGCACCTTGAGCGGCCAGGGCCGCCTCTACGACTATGGACAGAGGTTTGTGCTGGGCATGGGCAGCTCTTCCATTGAGCTTTGTGAG

CGGGAGTTTCAGAGGGGCTCCCTCAGCGACAGCAGCTCCTTCCTGGACACGCAGTGTGACAGCAGCGTCAGCAGCAGCGGCAAGCAAGATGGCTACGTGC

AGTTTGACAAGGCCAGCAAGGCTTCTGCCTCCTCTTCCCACCATTCCCAGTCCTCTTCCCAGAACTCCGACCCCAGCCGACCCCTGCAGCGGCGGATGCA

GACTCACGTCTGAGGACCACGCCCTGTGGTGGGGGATGGGCCAAGGAGGAGGACATGGTACATTCTCGTTCTCCAAGGATTGGGGCTACTTTGCAGAGGA

CCCTAGAACTGGCCACCTCCGGGGTGGTCTCCGAGCACCTCTGTAAACACCTTCCTTCAAAGCTCTGATCAAGCACAAATCTGGCTCCCAGGTGGGAAAT

GGAGAGTATGCAGCTGAGCGGATAGTGCTCAGGGCCTCTGTCTCTTGCTCTTCCCTAAAGGTCCCTCAACCACCTTGTCCTCCCATGGGCACTCGTGGCA

GCTAGAACTTTGCTTTTATGAAACTGCCGTCCACTTTCCTAGCTCCTCTTGCTGCCCATAAGCCATCCCTGGTGTCTGTATTCCTTGCAGCCTTGAGGAA

CGGAGGACTTTTTCCCAGCACTGAGCTGCTCCGGAGACCCCAGCCTCCCCACTGTGCATAGCCTATACCGCAGAGGCTGGGGCCTGAGAAATGGCCCTGA

CCAAAGGAGCATCTGCCTGGGAGTCCGCCCCCACTTTGTTTGGTGTTTGTGTCTGTATTCTTGCAGTTCTGTTCTTGGACTTGATACCTCTGCGCTTGGT

GGTGGGACTGGCCTATCAGAGTCTAGTGTCCTCAGAGCTGAGGAAGGGAAAGAGGGAAAATGTGAACTCCTGGAGAACAACTGGCCCAACACACCCTGTG

CCAGGCTGTGCAGTTCAGAGCCCTCACCGTCATCCTCACCCCCTGCCCCGTGTTCTCCCTTCCTTCCCACAGCACAATCGAGCTAATCCGAGGAGTGTGA

GAACTCCTCTTGTCAGGGTTTTTTGAACAGTTACTGAAGCGTGCTTCCTGGGAGATGTGGGTTTGAGGGGGTGCTGAAATCTAGGCTGGAGGATGAGACA

GACTCTTTCAGCTGATGACCACAAGGAACAATGATCCATTCTCCAGTAGATAGGACTCTGTGTGCAAGAGGGACAGTTTTCTTCACCTCTTTCCCATCAC

TCCCCACTTAAGAATAAACGTTAGGGCCATTACCCCCAACAAACCTGTTCTGTGCTTTTGTTTCTGCACATGCCACAGGAAGACCTCAAGAGTCCAAGTA

CATTGTGGGAGCTCAGACAATGTTTTTAGTTGATTGGTTGGAAGGGGGCTTTTTGTTATTGTTGTGTTATGTTTTGTTTGCTTTACTTCAGTTCTCCCCA

GGGAGGGAAGGTCATTGTAGGGGCTGGTTGTGGTCATTATAGAATCTACAAGTTAACACTCTGTTTGTGGATTACATTAGAGGGGGAAAAAACCAGGTTT

CACCAAACACCAACTTTAATTCTTGACAAATGTAGCTAAGTCAATACCATGACTTTGGACACTGGCCAGATCCTTCTAGCCTTTACAAGAAGCAGGCCCT

CTTGAAAGACTATAGATCACCACCAATACTCAACACTCAAGTATAGGAC
Translation
 MAKDKFRRMNEG GQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSS SYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQ

AIQAAIRSRPARLTVLV - UNI16289 - - UNI32975 - VPPDDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSK - 

UNI16289 - TLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQH HPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYR 

RWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYF FGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGV VLSN

EKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNG GPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRI AWSWKENVLESGTSGRYTVETVNTE

EGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQE ESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRN NLKGVVSAKNDIRVEIVHK

EPSSGREAEDHTTIKQLM MDRGEFQQDSVLKQLEVLKEEEKEFQNLK DPTNGYYSVNTFKEHHSTPTISLSSCQPDLRPTGKQRVPTGMSFTNIYSTL

SGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV
Transcript ENSMUST00000115147
Sequence
ATGAGACCTTTCCAGCTGGATTTGCTCTTCCTCTGCTTCTTCCTCTTCAGTCAAG GTCAAGTCTACTCCTTCAGCCAGCAACCCCAGGACCAAGTGGTG

GTGTCAGGACAGCCAGTGACTCTGCTGTGTGCCATCCCTGAATATGATGGCTTCGTCCTGTGGATCAAAGATGGCTTGGCTCTGGGTGTAGGCAGAGACC

TCTCAA GTTACCCCCAGTACCTGGTGGTGGGGAACCACCTCTCAGGAGAGCATCACCTGAAGATCCTGAGGGCTGAGCTTCAGGATGATGCCGTGTATG

AGTGCCAGGCCATCCAGGCTGCCATCCGGTCCCGCCCTGCACGCCTCACCGTCCTGG - UNI16289 - - UNI32975 - TGCCACCAGATGACCC

CATCATCCTAGGGGGGCCTGTGATCAGCCTTCGGGCAGGGGACCCCCTCAACCTCACCTGCCACGCAGACAATGCCAAGCCTGCGGCTTCCATCATCTGG

CTACGTAAAGGAGAGGTCATCAATGGAGCCACCTACTCCAAG - UNI16289 - ACCCTGCTTCGAGACGGCAAACGAGAAAGCATTGTCAGCACCCT

CTTCATCTCCCCAGGAGACGTGGAAAATGGACAGAGTATTGTGTGCCGAGCCACCAACAAAGCCATCCCCGGAGGAAAAGAGACCTCTGTCACCATAGAC

ATCCAGC ATCCACCGCTTGTCAACTTGTCCGTGGAACCACAGCCGGTATTGGAGGACAACATCGTCACGTTCCACTGCTCTGCAAAGGCCAACCCAGCT

GTCACCCAGTACAG GTGGGCCAAACGGGGTCACATCATCAAGGAGGCATCTGGGGAGCTGTATAGGACCACGGTGGACTACACATACTTCTCAGAGCCT

GTATCCTGTGAAGTAACCAATGCCCTGGGCAGCACCAACCTCAGCCGCACAGTGGATGTATACT TCGGTCCTCGAATGACCTCAGAGCCTCAGTCACTG

CTGGTAGATCTGGGCTCCGATGCTGTCTTCAGCTGTGCGTGGATCGGCAACCCGTCTCTGACCATCGTGTGGATGAAACGAGGTTCTGGTGTG GTCCTG

AGCAATGAAAAGACCCTAACCCTCAAATCTGTCCGCCAAGAGGATGCTGGGAAGTACGTGTGCCGGGCTGTGGTGCCCCGGGTAGGAGCTGGGGAGAGAG

AGGTGACCTTGACTGTCAATG GACCCCCCATCATCTCCAGCACACAGACCCAGCACGCCCTCCACGGAGAGAAGGGCCAGATCAAATGCTTCATCCGGA

GCACACCACCGCCTGACCGAATT GCCTGGTCCTGGAAGGAGAATGTGCTGGAGTCAGGGACATCAGGGCGCTACACAGTGGAGACGGTGAACACGGAGG

AGGGAGTCATCTCCACATTGACCATTAGCAACATTGTGCGTGCTGACTTCCAGACCATATACAACTGTACAGCCTGGAACAGCTTTGGCTCTGACACAGA

GATCATCCGACTCAAGGAACAAG GTTCGGAAATGAAGTCGGGAGCCGGGCTGGAAGCAG AGTCTGTACCAATGGCCGTCATCATCGGGGTGGCCGTAG

GAGCTGGCGTGGCCTTCCTCGTCCTAATGGCAACCATTGTGGCCTTCTGCTGTGCCCGTTCCCAGAGAAGTACGGGAGGGAGACCCGGGATCTCAGGGAG

GGGGACAGAGAAAAAGGCCAGGCTTAGACTGCCCAGGAGAGCAA ATCTCAAAGGTGTTGTATCAGCCAAAAATGATATTCGAGTGGAAATTGTGCACAA

GGAGCCATCTTCTGGCCGGGAGGCTGAGGACCACACCACCATAAAGCAGCTGATG ATGGACCGGGGTGAATTCCAACAAGACTCGGTGCTGAAACAGCT

GGAGGTCCTCAAAGAAGAGGAGAAGGAGTTTCAGAACCTGAAG GACCCCACCAACGGCTACTACAGCGTCAACACCTTCAAAGAACACCATTCAACTCC

AACCATCTCCCTGTCCAGCTGCCAGCCAGACCTGCGTCCGACAGGCAAACAGCGTGTGCCCACAGGCATGTCCTTCACCAACATCTACAGCACCTTGAGC

GGCCAGGGCCGCCTCTACGACTATGGACAGAGGTTTGTGCTGGGCATGGGCAGCTCTTCCATTGAGCTTTGTGAGCGGGAGTTTCAGAGGGGCTCCCTCA

GCGACAGCAGCTCCTTCCTGGACACGCAGTGTGACAGCAGCGTCAGCAGCAGCGGCAAGCAAGATGGCTACGTGCAGTTTGACAAGGCCAGCAAGGCTTC

TGCCTCCTCTTCCCACCATTCCCAGTCCTCTTCCCAGAACTCCGACCCCAGCCGACCCCTGCAGCGGCGGATGCAGACTCACGTCTGA
Translation
MRPFQLDLLFLCFFLFSQG GQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSS SYPQYLVVGNHLSGEHHLKILRAELQDD

AVYECQAIQAAIRSRPARLTVLV - UNI16289 - - UNI32975 - VPPDDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGAT

YSK - UNI16289 - TLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQH HPPLVNLSVEPQPVLEDNIVTFHCSAKANPA

VTQYR RWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYF FGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSG

V VLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNG GPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRI AWSWKENVLESGTSGRYTV

ETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQG GSEMKSGAGLEAE ESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRS

TGGRPGISGRGTEKKARLRLPRRAN NLKGVVSAKNDIRVEIVHKEPSSGREAEDHTTIKQLM MDRGEFQQDSVLKQLEVLKEEEKEFQNLK DPTNGY

YSVNTFKEHHSTPTISLSSCQPDLRPTGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQ

DGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV
Transcript ENSMUST00000115148
Sequence
ATGAGACCTTTCCAGCTGGATTTGCTCTTCCTCTGCTTCTTCCTCTTCAGTCAAG AGCTTGGCCTCCAGAAGAGAGGATGCTGTCTGGTACTGGGCTAC

ATGGCCAAGGACAAGTTTCGGAGAATGAATGAAG GTCAAGTCTACTCCTTCAGCCAGCAACCCCAGGACCAAGTGGTGGTGTCAGGACAGCCAGTGACT

CTGCTGTGTGCCATCCCTGAATATGATGGCTTCGTCCTGTGGATCAAAGATGGCTTGGCTCTGGGTGTAGGCAGAGACCTCTCAA GTTACCCCCAGTAC

CTGGTGGTGGGGAACCACCTCTCAGGAGAGCATCACCTGAAGATCCTGAGGGCTGAGCTTCAGGATGATGCCGTGTATGAGTGCCAGGCCATCCAGGCTG

CCATCCGGTCCCGCCCTGCACGCCTCACCGTCCTGG - UNI16289 - - UNI32975 - TGCCACCAGATGACCCCATCATCCTAGGGGGGCCTGT

GATCAGCCTTCGGGCAGGGGACCCCCTCAACCTCACCTGCCACGCAGACAATGCCAAGCCTGCGGCTTCCATCATCTGGCTACGTAAAGGAGAGGTCATC

AATGGAGCCACCTACTCCAAG - UNI16289 - ACCCTGCTTCGAGACGGCAAACGAGAAAGCATTGTCAGCACCCTCTTCATCTCCCCAGGAGACGT

GGAAAATGGACAGAGTATTGTGTGCCGAGCCACCAACAAAGCCATCCCCGGAGGAAAAGAGACCTCTGTCACCATAGACATCCAGC ATCCACCGCTTGT

CAACTTGTCCGTGGAACCACAGCCGGTATTGGAGGACAACATCGTCACGTTCCACTGCTCTGCAAAGGCCAACCCAGCTGTCACCCAGTACAG GTGGGC

CAAACGGGGTCACATCATCAAGGAGGCATCTGGGGAGCTGTATAGGACCACGGTGGACTACACATACTTCTCAGAGCCTGTATCCTGTGAAGTAACCAAT

GCCCTGGGCAGCACCAACCTCAGCCGCACAGTGGATGTATACT TCGGTCCTCGAATGACCTCAGAGCCTCAGTCACTGCTGGTAGATCTGGGCTCCGAT

GCTGTCTTCAGCTGTGCGTGGATCGGCAACCCGTCTCTGACCATCGTGTGGATGAAACGAGGTTCTGGTGTG GTCCTGAGCAATGAAAAGACCCTAACC

CTCAAATCTGTCCGCCAAGAGGATGCTGGGAAGTACGTGTGCCGGGCTGTGGTGCCCCGGGTAGGAGCTGGGGAGAGAGAGGTGACCTTGACTGTCAATG

 GACCCCCCATCATCTCCAGCACACAGACCCAGCACGCCCTCCACGGAGAGAAGGGCCAGATCAAATGCTTCATCCGGAGCACACCACCGCCTGACCGAA

TT GCCTGGTCCTGGAAGGAGAATGTGCTGGAGTCAGGGACATCAGGGCGCTACACAGTGGAGACGGTGAACACGGAGGAGGGAGTCATCTCCACATTGA

CCATTAGCAACATTGTGCGTGCTGACTTCCAGACCATATACAACTGTACAGCCTGGAACAGCTTTGGCTCTGACACAGAGATCATCCGACTCAAGGAACA

AG GTTCGGAAATGAAGTCGGGAGCCGGGCTGGAAGCAG AGTCTGTACCAATGGCCGTCATCATCGGGGTGGCCGTAGGAGCTGGCGTGGCCTTCCTCG

TCCTAATGGCAACCATTGTGGCCTTCTGCTGTGCCCGTTCCCAGAGAA ATCTCAAAGGTGTTGTATCAGCCAAAAATGATATTCGAGTGGAAATTGTGC

ACAAGGAGCCATCTTCTGGCCGGGAGGCTGAGGACCACACCACCATAAAGCAGCTGATG ATGGACCGGGGTGAATTCCAACAAGACTCGGTGCTGAAAC

AGCTGGAGGTCCTCAAAGAAGAGGAGAAGGAGTTTCAGAACCTGAAG GACCCCACCAACGGCTACTACAGCGTCAACACCTTCAAAGAACACCATTCAA

CTCCAACCATCTCCCTGTCCAGCTGCCAGCCAGACCTGCGTCCGACAGGCAAACAGCGTGTGCCCACAGGCATGTCCTTCACCAACATCTACAGCACCTT

GAGCGGCCAGGGCCGCCTCTACGACTATGGACAGAGGTTTGTGCTGGGCATGGGCAGCTCTTCCATTGAGCTTTGTGAGCGGGAGTTTCAGAGGGGCTCC

CTCAGCGACAGCAGCTCCTTCCTGGACACGCAGTGTGACAGCAGCGTCAGCAGCAGCGGCAAGCAAGATGGCTACGTGCAGTTTGACAAGGCCAGCAAGG

CTTCTGCCTCCTCTTCCCACCATTCCCAGTCCTCTTCCCAGAACTCCGACCCCAGCCGACCCCTGCAGCGGCGGATGCAGACTCACGTCTGA
Translation
MRPFQLDLLFLCFFLFSQE ELGLQKRGCCLVLGYMAKDKFRRMNEG GQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSS 

SYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLV - UNI16289 - - UNI32975 - VPPDDPIILGGPVISLRAGDPL

NLTCHADNAKPAASIIWLRKGEVINGATYSK - UNI16289 - TLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQH HPP

LVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYR RWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYF FGPRMTSEPQSLLV

DLGSDAVFSCAWIGNPSLTIVWMKRGSGV VLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNG GPPIISSTQTQHALHGEKGQIKCFIR

STPPPDRI AWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQG GSEMKSGAGLEAE ESVPMAVII

GVAVGAGVAFLVLMATIVAFCCARSQRN NLKGVVSAKNDIRVEIVHKEPSSGREAEDHTTIKQLM MDRGEFQQDSVLKQLEVLKEEEKEFQNLK DPT

NGYYSVNTFKEHHSTPTISLSSCQPDLRPTGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSS

GKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV
Transcript ENSMUST00000077837
Sequence
ATGAGACCTTTCCAGCTGGATTTGCTCTTCCTCTGCTTCTTCCTCTTCAGTCAAG AGCTTGGCCTCCAGAAGAGAGGATGCTGTCTGGTACTGGGCTAC

ATGGCCAAGGACAAGTTTCGGAGAATGAATGAAG GTCAAGTCTACTCCTTCAGCCAGCAACCCCAGGACCAAGTGGTGGTGTCAGGACAGCCAGTGACT

CTGCTGTGTGCCATCCCTGAATATGATGGCTTCGTCCTGTGGATCAAAGATGGCTTGGCTCTGGGTGTAGGCAGAGACCTCTCAA GTTACCCCCAGTAC

CTGGTGGTGGGGAACCACCTCTCAGGAGAGCATCACCTGAAGATCCTGAGGGCTGAGCTTCAGGATGATGCCGTGTATGAGTGCCAGGCCATCCAGGCTG

CCATCCGGTCCCGCCCTGCACGCCTCACCGTCCTGG - UNI16289 - - UNI32975 - TGCCACCAGATGACCCCATCATCCTAGGGGGGCCTGT

GATCAGCCTTCGGGCAGGGGACCCCCTCAACCTCACCTGCCACGCAGACAATGCCAAGCCTGCGGCTTCCATCATCTGGCTACGTAAAGGAGAGGTCATC

AATGGAGCCACCTACTCCAAG - UNI16289 - ACCCTGCTTCGAGACGGCAAACGAGAAAGCATTGTCAGCACCCTCTTCATCTCCCCAGGAGACGT

GGAAAATGGACAGAGTATTGTGTGCCGAGCCACCAACAAAGCCATCCCCGGAGGAAAAGAGACCTCTGTCACCATAGACATCCAGC ATCCACCGCTTGT

CAACTTGTCCGTGGAACCACAGCCGGTATTGGAGGACAACATCGTCACGTTCCACTGCTCTGCAAAGGCCAACCCAGCTGTCACCCAGTACAG GTGGGC

CAAACGGGGTCACATCATCAAGGAGGCATCTGGGGAGCTGTATAGGACCACGGTGGACTACACATACTTCTCAGAGCCTGTATCCTGTGAAGTAACCAAT

GCCCTGGGCAGCACCAACCTCAGCCGCACAGTGGATGTATACT TCGGTCCTCGAATGACCTCAGAGCCTCAGTCACTGCTGGTAGATCTGGGCTCCGAT

GCTGTCTTCAGCTGTGCGTGGATCGGCAACCCGTCTCTGACCATCGTGTGGATGAAACGAGGTTCTGGTGTG GTCCTGAGCAATGAAAAGACCCTAACC

CTCAAATCTGTCCGCCAAGAGGATGCTGGGAAGTACGTGTGCCGGGCTGTGGTGCCCCGGGTAGGAGCTGGGGAGAGAGAGGTGACCTTGACTGTCAATG

 GACCCCCCATCATCTCCAGCACACAGACCCAGCACGCCCTCCACGGAGAGAAGGGCCAGATCAAATGCTTCATCCGGAGCACACCACCGCCTGACCGAA

TT GCCTGGTCCTGGAAGGAGAATGTGCTGGAGTCAGGGACATCAGGGCGCTACACAGTGGAGACGGTGAACACGGAGGAGGGAGTCATCTCCACATTGA

CCATTAGCAACATTGTGCGTGCTGACTTCCAGACCATATACAACTGTACAGCCTGGAACAGCTTTGGCTCTGACACAGAGATCATCCGACTCAAGGAACA

AG AGTCTGTACCAATGGCCGTCATCATCGGGGTGGCCGTAGGAGCTGGCGTGGCCTTCCTCGTCCTAATGGCAACCATTGTGGCCTTCTGCTGTGCCCG

TTCCCAGAGAA ATCTCAAAGGTGTTGTATCAGCCAAAAATGATATTCGAGTGGAAATTGTGCACAAGGAGCCATCTTCTGGCCGGGAGGCTGAGGACCA

CACCACCATAAAGCAGCTGATG ATGGACCGGGGTGAATTCCAACAAGACTCGGTGCTGAAACAGCTGGAGGTCCTCAAAGAAGAGGAGAAGGAGTTTCA

GAACCTGAAG GACCCCACCAACGGCTACTACAGCGTCAACACCTTCAAAGAACACCATTCAACTCCAACCATCTCCCTGTCCAGCTGCCAGCCAGACCT

GCGTCCGACAGGCAAACAGCGTGTGCCCACAGGCATGTCCTTCACCAACATCTACAGCACCTTGAGCGGCCAGGGCCGCCTCTACGACTATGGACAGAGG

TTTGTGCTGGGCATGGGCAGCTCTTCCATTGAGCTTTGTGAGCGGGAGTTTCAGAGGGGCTCCCTCAGCGACAGCAGCTCCTTCCTGGACACGCAGTGTG

ACAGCAGCGTCAGCAGCAGCGGCAAGCAAGATGGCTACGTGCAGTTTGACAAGGCCAGCAAGGCTTCTGCCTCCTCTTCCCACCATTCCCAGTCCTCTTC

CCAGAACTCCGACCCCAGCCGACCCCTGCAGCGGCGGATGCAGACTCACGTCTGAGGACCACGCCCTGTGGTGGGGGATGGGCCAAGGAGGAGGACATGG

TACATTCTCGTTCTCCAAGGATTGGGGCTACTTTGCAGAGGACCCTAGAACTGGCCACCTCCGGGGTGGTCTCCGAGCACCTCTGTAAACACCTTCCTTC

AAAGCTCTGATCAAGCACAAATCTGGCTCCCAGGTGGGAAATGGAGAGTATGCAGCTGAGCGGATAGTGCTCAGGGCCTCTGTCTCTTGCTCTTCCCTAA

AGGTCCCTCAACCACCTTGTCCTCCCATGGGCACTCGTGGCAGCTAGAACTTTGCTTTTATGAAACTGCCGTCCACTTTCCTAGCTCCTCTTGCTGCCCA

TAAGCCATCCCTGGTGTCTGTATTCCTTGCAGCCTTGAGGAACGGAGGACTTTTTCCCAGCACTGAGCTGCTCCGGAGACCCCAGCCTCCCCACTGTGCA

TAGCCTATACCGCAGAGGCTGGGGCCTGAGAAATGGCCCTGACCAAAGGAGCATCTGCCTGGGAGTCCGCCCCCACTTTGTTTGGTGTTTGTGTCTGTAT

TCTTGCAGTTCTGTTCTTGGACTTGATACCTCTGCGCTTGGTGGTGGGACTGGCCTATCAGAGTCTAGTGTCCTCAGAGCTGAGGAAGGGAAAGAGGGAA

AATGTGAACTCCTGGAGAACAACTGGCCCAACACACCCTGTGCCAGGCTGTGCAGTTCAGAGCCCTCACCGTCATCCTCACCCCCTGCCCCGTGTTCTCC

CTTCCTTCCCACAGCACAATCGAGCTAATCCGAGGAGTGTGAGAACTCCTCTTGTCAGGGTTTTTTGAACAGTTACTGAAGCGTGCTTCCTGGGAGATGT

GGGTTTGAGGGGGTGCTGAAATCTAGGCTGGAGGATGAGACAGACTCTTTCAGCTGATGACCACAAGGAACAATGATCCATTCTCCAGTAGATAGGACTC

TGTGTGCAAGAGGGACAGTTTTCTTCACCTCTTTCCCATCACTCCCCACTTAAGAATAAACGTTAGGGCCATTACCCCC
Translation
MRPFQLDLLFLCFFLFSQE ELGLQKRGCCLVLGYMAKDKFRRMNEG GQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSS 

SYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLV - UNI16289 - - UNI32975 - VPPDDPIILGGPVISLRAGDPL

NLTCHADNAKPAASIIWLRKGEVINGATYSK - UNI16289 - TLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQH HPP

LVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYR RWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYF FGPRMTSEPQSLLV

DLGSDAVFSCAWIGNPSLTIVWMKRGSGV VLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNG GPPIISSTQTQHALHGEKGQIKCFIR

STPPPDRI AWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQE ESVPMAVIIGVAVGAGVAFLVLM

ATIVAFCCARSQRN NLKGVVSAKNDIRVEIVHKEPSSGREAEDHTTIKQLM MDRGEFQQDSVLKQLEVLKEEEKEFQNLK DPTNGYYSVNTFKEHHS

TPTISLSSCQPDLRPTGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASK

ASASSSHHSQSSSQNSDPSRPLQRRMQTHV

For any suggestions or comments, please send an email to unitrap@crg.es