Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032066 (Bcdo2)
Chromosomal location
Chr 9: 50341192 - 50363286 (-)
Description
beta-carotene oxygenase 2 Gene [Source:MGI (curated);Acc:Bcdo2-001]
Human Ortholog
not available
Omim not available
UniTrap UNI37144
Vector Insertion
Chr 9: 50341191 - 50341625
Public Clones CMHD-GT_515B8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119103
Sequence
GGCTCATTATTTACTTAATCAGGCCAGTGGCTGCAGATTCAGAAATCTCAAGACCTGAGTTAAGAACTGAGTTAAATACTATTTCTCAACTGTTTCTGCG

TTTCCTCAGCAGCCTTCTTGACACCGCAGGGTTCTTCCTGTGGCAGTGTACCATCGCCCAG TTTTGAAGGAGTATGTGAGGGAATACTCACCAGGAAAC

CATGTTGGGACCGAAGCAGAGCCTGCCATGCATTGCCCCACTGCTGACCACGGCGGAGGAGACTCTGAGTGCTGTCTCTGCTCGGGTCCGAGGACATATT

CCTGAATGGCTTAATGGTTATCTACTTCGAGTTGGACCTGGGAAGTTTGAATTTGGGAAGGATAG ATACAATCATTGGTTTGATGGAATGGCGTTGCTT

CACCAGTTCCGAATGGAGAGGGGCACAGTGACATACAAGAGCAAGTTTCTACAGAGTGACACATATAAGGCCAACAGTGCTGGAGGTAGAATTGTGATCT

CAGAATTTGGCACGCTGGCCCTTCCTGACCCATGCAAGAGCATCTTTGAACGTTTCATGTCAAGGTTTGAGCCACCTA CTATGACTGACAACACCAACG

TCAACTTTGTGCAGTACAAAGGTGATTACTACATGAGCACAGAGACTAATTTTATGAATAAGGTGGACATTGAGATGCTGGAAAGGACAGAAAAG GTGG

ACTGGAGCAAATTCATTGCTGTGAATGGAGCCACTGCACATCCTCATTACGACCCAGATGGGACAGCATACAACATGGGGAACAGCTATGGGCCAAGAG 

GTTCTTGCTATAATATTATTCGTGTTCCTCCAAAAAAGAAAGAGCCCGGGGAGACGATTCACGGAGCACAGGTGCTATGTTCCATTGCCTCCACTGAGAA

AATGAAGCCTTCTTACTACCATAGCTTTG GAATGACAAAAAACTACATAATCTTTGTCGAACAGCCTGTAAAGATGAAGCTGTGGAAAATAATCACTTC

TAAAATCCGGGGAAAGCCCTTTGCTGATGGGATAAGCTGGGAGCCCCAGTATAACACGCGGTTTCATGTGGTGGATAAACACACTGGACAG CTTCTCCC

AGGAATGTACTACAGCATGCCTTTTCTTACCTATCATCAAATCAATGCCTTTGAGGACCAGGGCTGTATTGTGATTGATCTGTGCTGCCAGGATGATGGG

AGAAGCCTAGACCTTTACCAACTACAGAATCTCAGGAAAGCTGGAGAGGGGCTTGATCAG GTCTATGAGTTAAAGGCAAAGTCTTTCCCTCGAAGATTT

GTCTTGCCCTTAGATGTTAGTGTGGATGCTGCTGAAGGAAAGAACCTCAGCCCACTGTCCTATTCTTCAGCCAGCGCTGTGAAACAGGGTGATGGAGAG 

ATCTGGTGCTCTCCTGAAAATCTACACCACGAAGACCTGGAAGAGGAAGGGGGGATTGAATTCCCTCAGATCAACTATGGCCGATTCAATGGCAAAAAGT

ATAGTTTCTTCTATGGCTGCGGTTTTCGACATTTGGTGGGGGATTCTCTGATTAAGGTTGACGTGACGAACAAGACACTAAGG GTTTGGAGAGAAGAAG

GCTTTTATCCCTCGGAGCCCGTTTTTGTTCCGGTGCCAGGAGCAGATGAGGAAGACAGTGGGGTTATACTCTCTGTGGTGATCACTCCCAACCAG - UN

I37144 - AGTGAAAGCAACTTCCTCCTTGTCTTGGATGCCAAGAGCTTCACAGAGCTGGGGCGAGCGGAAGTACCCGTGCAGATGCCTTACGGGTTCC

ATGGCACCTTTGTGCCTATCTGACGGCAGAGGCGCAAGGAAGGCTAGGATCGGGCTTCGATGAGCACACTCTGAGGAAAAGAGAAAATGGTGGATCTCAC

TCAAAAGCTGTTGTAGTTTGGACCTGACCCTGACCCCTAAGGACTCATAGACCCGACTCCCGTGGGCTCATCGACCCTGACCCCCAACGTGCTGATAGAT

CCTGACCACCACGGGATCATATTTAAATTCTTGTTCCCAGCTTGTGGCACTACTTTTTTTTTTTTTGTAGCAGTGGTAAAATAACTAATAATCTCCCCAT

GTATGGTTTTATATTTCTATTAAAACACAACTTGTGAGGTAA
Translation
 MLGPKQSLPCIAPLLTTAEETLSAVSARVRGHIPEWLNGYLLRVGPGKFEFGKDR RYNHWFDGMALLHQFRMERGTVTYKSKFLQSDTYKANSAGGRI

VISEFGTLALPDPCKSIFERFMSRFEPPT TMTDNTNVNFVQYKGDYYMSTETNFMNKVDIEMLERTEK VDWSKFIAVNGATAHPHYDPDGTAYNMGNS

YGPRG GSCYNIIRVPPKKKEPGETIHGAQVLCSIASTEKMKPSYYHSFG GMTKNYIIFVEQPVKMKLWKIITSKIRGKPFADGISWEPQYNTRFHVVD

KHTGQ LLPGMYYSMPFLTYHQINAFEDQGCIVIDLCCQDDGRSLDLYQLQNLRKAGEGLDQ VYELKAKSFPRRFVLPLDVSVDAAEGKNLSPLSYSSA

SAVKQGDGE IWCSPENLHHEDLEEEGGIEFPQINYGRFNGKKYSFFYGCGFRHLVGDSLIKVDVTNKTLR VWREEGFYPSEPVFVPVPGADEEDSGVI

LSVVITPNQ - UNI37144 - SESNFLLVLDAKSFTELGRAEVPVQMPYGFHGTFVPI
Transcript ENSMUST00000034569
Sequence
ATGTTGGGACCGAAGCAGAGCCTGCCATGCATTGCCCCACTGCTGACCACGGCGGAGGAGACTCTGAGTGCTGTCTCTGCTCGGGTCCGAGGACATATTC

CTGAATGGCTTAATGGTTATCTACTTCGAGTTGGACCTGGGAAGTTTGAATTTGGGAAGGATAG ATACAATCATTGGTTTGATGGAATGGCGTTGCTTC

ACCAGTTCCGAATGGAGAGGGGCACAGTGACATACAAGAGCAAGTTTCTACAGAGTGACACATATAAGGCCAACAGTGCTGGAGGTAGAATTGTGATCTC

AGAATTTGGCACGCTGGCCCTTCCTGACCCATGCAAGAGCATCTTTGAACGTTTCATGTCAAGGTTTGAGCCACCTA CTATGACTGACAACACCAACGT

CAACTTTGTGCAGTACAAAGGTGATTACTACATGAGCACAGAGACTAATTTTATGAATAAGGTGGACATTGAGATGCTGGAAAGGACAGAAAAG GTGGA

CTGGAGCAAATTCATTGCTGTGAATGGAGCCACTGCACATCCTCATTACGACCCAGATGGGACAGCATACAACATGGGGAACAGCTATGGGCCAAGAG G

TTCTTGCTATAATATTATTCGTGTTCCTCCAAAAAAGAAAGAGCCCGGGGAGACGATTCACGGAGCACAGGTGCTATGTTCCATTGCCTCCACTGAGAAA

ATGAAGCCTTCTTACTACCATAGCTTTG GAATGACAAAAAACTACATAATCTTTGTCGAACAGCCTGTAAAGATGAAGCTGTGGAAAATAATCACTTCT

AAAATCCGGGGAAAGCCCTTTGCTGATGGGATAAGCTGGGAGCCCCAGTATAACACGCGGTTTCATGTGGTGGATAAACACACTGGACAG CTTCTCCCA

GGAATGTACTACAGCATGCCTTTTCTTACCTATCATCAAATCAATGCCTTTGAGGACCAGGGCTGTATTGTGATTGATCTGTGCTGCCAGGATGATGGGA

GAAGCCTAGACCTTTACCAACTACAGAATCTCAGGAAAGCTGGAGAGGGGCTTGATCAG GTCTATGAGTTAAAGGCAAAGTCTTTCCCTCGAAGATTTG

TCTTGCCCTTAGATGTTAGTGTGGATGCTGCTGAAGGAAAGAACCTCAGCCCACTGTCCTATTCTTCAGCCAGCGCTGTGAAACAGGGTGATGGAGAG A

TCTGGTGCTCTCCTGAAAATCTACACCACGAAGACCTGGAAGAGGAAGGGGGGATTGAATTCCCTCAGATCAACTATGGCCGATTCAATGGCAAAAAGTA

TAGTTTCTTCTATGGCTGCGGTTTTCGACATTTGGTGGGGGATTCTCTGATTAAGGTTGACGTGACGAACAAGACACTAAGG GTTTGGAGAGAAGAAGG

CTTTTATCCCTCGGAGCCCGTTTTTGTTCCGGTGCCAGGAGCAGATGAGGAAGACAGTGGGGTTATACTCTCTGTGGTGATCACTCCCAACCAG - UNI

37144 - AGTGAAAGCAACTTCCTCCTTGTCTTGGATGCCAAGAGCTTCACAGAGCTGGGGCGAGCGGAAGTACCCGTGCAGATGCCTTACGGGTTCCA

TGGCACCTTTGTGCCTATCTGACGGCAGAGGCGCAAGGAAGGCTAGGATCGGGCTTCGATGAGCACACTCTGAGGAAAAGAGAAAATGGTGGATCTCACT

CAAAAGCTGTTGTAGTTTGGACCTGACCCTGACCCCTAAGGACTCATAGACCCGACTCCCGTGGGCTCATCGACCCTGACCCCCAACGTGCTGATAGATC

CTGACCACCACGGGATCATATTTAAATTCTTGTTCCCAGCTTGTGGCACTACTTTTTTTTTTTTTGTAGCAGTGGTA
Translation
MLGPKQSLPCIAPLLTTAEETLSAVSARVRGHIPEWLNGYLLRVGPGKFEFGKDR RYNHWFDGMALLHQFRMERGTVTYKSKFLQSDTYKANSAGGRIV

ISEFGTLALPDPCKSIFERFMSRFEPPT TMTDNTNVNFVQYKGDYYMSTETNFMNKVDIEMLERTEK VDWSKFIAVNGATAHPHYDPDGTAYNMGNSY

GPRG GSCYNIIRVPPKKKEPGETIHGAQVLCSIASTEKMKPSYYHSFG GMTKNYIIFVEQPVKMKLWKIITSKIRGKPFADGISWEPQYNTRFHVVDK

HTGQ LLPGMYYSMPFLTYHQINAFEDQGCIVIDLCCQDDGRSLDLYQLQNLRKAGEGLDQ VYELKAKSFPRRFVLPLDVSVDAAEGKNLSPLSYSSAS

AVKQGDGE IWCSPENLHHEDLEEEGGIEFPQINYGRFNGKKYSFFYGCGFRHLVGDSLIKVDVTNKTLR VWREEGFYPSEPVFVPVPGADEEDSGVIL

SVVITPNQ - UNI37144 - SESNFLLVLDAKSFTELGRAEVPVQMPYGFHGTFVPI

For any suggestions or comments, please send an email to unitrap@crg.es