Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032076 (Cadm1)
Chromosomal location
Chr 9: 47338256 - 47661468 (+)
Description
cell adhesion molecule 1 Gene [Source:MGI (curated);Acc:Cadm1-001]
RefSeq_dna
NM_207675 NM_207676 NM_001025600 NM_018770 
RefSeq_peptide
NP_997558.2 NP_997559.1 NP_001020771.1 NP_061240.3 
UniGene
Mm.412773 Mm.472882 
MGI
MGI:1889272 
Uniprot/SWISSPROT
Q8R5M8 
Uniprot/SPTREMBL
Q9QYL4 Q1WIL9 Q9QYL3 B5L830 
Human Ortholog
ENSG00000182985 (CADM1)
Omim not available
UniTrap UNI4028
Vector Insertion
Chr 9: 47338339 - 47338589
Public Clones AQ0594 (sanger) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14535
Vector Insertion
Chr 9: 47338589 - 47596049
Public Clones (sanger) E324F02 (ggtc) D075F03 (ggtc) D188D12 (ggtc) D075G04 (ggtc)
FHCRC-GT-S7-2C1 (fhcrc) IST14481A6 (tigm) IST10068C10 (tigm) IST10836B6 (tigm)
IST10604D11 (tigm) IST13490C3 (tigm) IST12933A7 (tigm) IST12838A6 (tigm)
IST12887E5 (tigm) IST13891B12 (tigm) IST13740G6 (tigm) IST11899E3 (tigm)
IST14699G6 (tigm) IST11029G1 (tigm) IST13705A7 (tigm) IST10224A1 (tigm)
IST12379E1 (tigm) IST11343C2 (tigm) IST13692A6 (tigm) IST11151B8 (tigm)
IST13791B1 (tigm) IST10685E11 (tigm) IST10836C6 (tigm) IST11248E11 (tigm)
IST11732E12 (tigm) IST13899D2 (tigm) IST11945H7 (tigm) IST11317C1 (tigm)
IST11761H2 (tigm) IST12265E12 (tigm) IST14086E6 (tigm) IST12738E6 (tigm)
IST11263A1 (tigm) IST12758G11 (tigm) IST11627C12 (tigm) IST10515D4 (tigm)
IST10078B6 (tigm) IST11122C8 (tigm) IST14500E5 (tigm) IST11484G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18862
Vector Insertion
Chr 9: 47596053 - 47596201
Public Clones not available
Private Clones OST412831 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8419
Vector Insertion
Chr 9: 47597933 - 47605489
Public Clones XI486 (baygenomics)
Private Clones OST77805 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37049
Vector Insertion
Chr 9: 47618227 - 47621855
Public Clones CMHD-GT_528D4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114542
Sequence
AAAGGTGATGGACAGAATCTGTTTACTAAAGACGTGACAGTGATTGAAGGAGAAGTGGCAACCATCAGCTGCCAGGTCAATAAGAGTGACGACTCAGTGA

TCCAGCTCCTGAACCCCAACAGGCAGACCATTTACTTCAGGGACTTCAGGC - UNI18862 - CTTTGAAGGACAGCAGGTTTCAGCTGCTGAATTTT

TCTAGCAGTGAACTCAAAGTGTCACTGACGAATGTCTCAATCTCGGATGAAGGGAGATACTTCTGCCAGCTCTACACGGACCCCCCACAGGAGAGTTACA

CCACCATCACAGTCCTGG - UNI8419 - TTCCTCCACGTAACTTGATGATCGATATCCAGAAAGACACGGCAGTTGAAGGGGAGGAGATTGAAGTCA

ACTGTACTGCCATGGCCAGCAAGCCAGCGACGACCATCAGGTGGTTCAAAGGGAACAAGGAACTCAAAG GCAAATCAGAGGTGGAGGAGTGGTCGGACA

TGTACACTGTGACCAGTCAGCTGATGCTGAAGGTGCACAAGGAGGACGACGGGGTCCCGGTGATCTGCCAGGTGGAGCACCCTGCGGTCACTGGAAACCT

GCAGACCCAGCGCTATCTAGAAGTGCAGT ATAAACCGCAAGTGCATATCCAGATGACTTACCCTCTGCAAGGCCTAACCCGGGAAGGGGATGCATTTGA

GTTAACGTGTGAAGCCATCGGGAAGCCCCA GCCTGTGATGGTAACTTGGGTGAGAGTCGATGATGAAATGCCTCAACATGCCGTACTGTCTGGGCCAAA

CCTGTTCATCAATAACCTAAACAAAACAGATAACGGTACTTACCGCTGTGAGGCTTCCAACATAGTGGGAAAGGCTCATTCGGACTATATGCTGTATGTA

TACG ATCCCCCCACAACTATCCCTCCTCCCACAACAACCACCACCACTACCACCACCACCACCACCACCATCCTTACCATCATCACAG ACACCACGGC

GACGACAGAACCAGCAGTTCACG ATTCTCGAGCAGGTGAAGAGGGGACCATTGGGGCAGTGGACCACGCAGTGATTGGTGGCGTCGTAGCCGTGGTGGT

GTTTGCCATGCTATGCTTGCTCATCATTCTGGGCCGCTATTTTGCCAGACATAAAG GTACATACTTCACTCATGAAGCCAAAGGAGCCGATGACGCAGC

AGACGCAGACACAGCTATAATCAATGCAGAAGGAGGACAGAACAACTCCGAAGAAAAGAAAGAGTACTTCATCTAGATCAGCCTTTTTGTTCCAATGAGG

TGTCCAACTGGCCTGTTTAGATGATAAAGAGACAGTGATACTGGAACTTTCGAGAAGCTCGTGTGGTTTTTTGTTTTGTTTTGTTTTTTTATGAGTGGGT

GGAGAGATGCGAGACTGGGAAGGCTTGGGATTTGCAATGTACAAACAAAAACAAAGAATGTTCTTTGAAAGTACACTCTGCTGTTTGACACCTCTTTTTA

ATCTGGTTTTAATTTGCTTTGGGTTTTGGGTTTTTTTGGTTTTTTGTTTTTTTCATTTATATTTCTTCCTACCAAGTCAAACTTGGGTACTTGGATTTGG

TTTCGGTAGATTGCAGAAAATTCTGTGCCTTGTTTTTCATTCGTTTGTTGTGTTTCTTCCCTCTTGCCCATTTATTTTTCCCAAAATCAAATTTGTTTTT

TTCCCCCTCCCAAACCTCCCATTTTTTGGAATTGACCTGCTGGAATTCCTAAGACTTTCTCCCTGTTGCCAGTTTCTTTTATTTGTGTTAACGGTGACTG

CTTTCTGTTCCAAATTCAGTTTCATAAAAGGAAAACCAGCACAATTTAGATTTCATAGTTCAGAATTTAGTGTCTCCATGATGCATCCTTCTCTGTTGTT

GTAAAGATTTGGGTGAAGAAAAAAAAAAAAAAAGAAAAAAAAAAGAAAAAAAAAAGAAAACACTGAAAACTCTTTGCTGCTGCCCATGTCTTAAATACGT

AGAGCAGCGAAGACTAGAAACGTAGACTGTGACCCAGACGCTGTCGTCTGCTGTGGATCTTCATTACTGTACAGGGTTATCTGCAAGTGAGGTGTGTCGC

AATGAGATTGAATCTGTCGTTAATTCTTTATCTGTAGGCGGCTCAGTATAGATTACCCCACGCTGTGCAGAAAGTTTTTGGAGTGGAAAGGTCTCCTCCT

TCCTCGTTGCCCTAAACAGACCCGACATGTGAGGTCTGTCTGTTTTATGTAAGTGGACAAATTTGAGATGTCACAGGAGGGGAAGCAGGGAGGGGGTACG

ACAGTTCTGCTCTGATTATTTCTACTCTCAACAATTCCATCCACCTTTCCCAATTGGCCTTACTGCTCACTAATGCAGGAGAGAGCAAGTCCGTGTGCCG

TGTGACTGACTGGAGGGGACAGGCTTTGTTTAGGTTTTTTTTACCCCCACTTTGGTTTTGGTTCTGGGTTGTTTTGCTTTGTTTTGTTTTCCTTTGTTCT

TATTAAGGACGGCAGTGGGCTGTGTCCTGTGTGTACTGTATGTTACAGACACCGTCCTGCTGGGACACTTGTCCTGCTGGGATTCCCAGCTCCCACCCCC

AACTCCTCTCATTCCTTCAGATTTGGCTTGACAAAGGCAGGAGGTACAAAAGAAGGGCCAATTTTGTTCTGGAAAGGTCAGAGCCCAGAGTCGAGGTGGG

AAAGTGGCATATAGGGATTTCCAGTTACTTAATCAAAACTCAAAATGTGAGTGTTTCTGTCTTTCGTGCACTAGGCCTGGCCTCTTACCTCAGCCTTAAG

AACCATCTGCCAAAAACTACTCATCTCGCATGATGGCAGCCAGAGCGCATAGCTACTAAAATAAGTTTCCGTGAACATATCTTACACCGGAGCCTGAGGA

AAGATAGAGGCGCAAAGGAACCCTTTGCATTCTCTAAAGCTAAGTGGGGGTTTGCAGAAGTGCTGGGGTCATCTAGCAGTAGTTCTGAAGGACAGAACCT

AAACTCTTACCACACGTGTCGGTAAGCTCCAGACTCCAAAACAGCCCCTCTGGAAAGATGGCATCAGAAAAGATAGATCTATCTATATATATAAATATAT

AAATATATATTATATATAACATTTTCAGTCAGTACTTTTGGATTTTGCAAGGTGCATTTTTACTATTGTTACATTATGTGGAAAACCTACGCTGATTTAT

TTAAGGGGAAAAAAGTGTCGACTCTGTTCTTTGAAAGCGTATTTCTTTTTCTTGTCTTTATTTTAACTTCTGATAGAACCACTGCAATATGGGGGCCTTT

TGGGAACGGACTGGTTTGTAAAGGAAAATTCATTATGGAGCAGTGTTTTGTTAACCCCTCTCCTGCCCCTAGGCACTTAACCAAGACAAAAAGCCACAAG

GAACATCCCTTTTTCAAAAATTTTATAATGTGCATCTATTCCGAGCCCTTAGCACCCATCCTGACCATAGTGACCATATCAAAGGGTGACAACCAGTTAG

CATGTCGTTGAAAGGGTTTTTCAGCTGTTCTTTTTAGAAAAAAAATATATATAAAAAATATTTAAAAAAAAACAAAAAACAAACAAACACAAAAAAACTA

CCATTGTTCACAGAATTGGCATCTCATTTTCGGGACCGCCCATCTTTCTGTTTTGACAAGTGTACAGTAGTGCAGTGTTCTGATGTAACTTTATGGCTTA

CAATGTTGACATGTCTCAGGTTCCTGTGTTTCAATTGGTGTTTTTCCGTCTCAGGTAGATTGCAAAGTGTAGGCCCCACACATTGGAAAAATAATAATAA

TAATAAATAATAATAATAATAATAATAATAAAACAAAGCAAAAACAGGAAATTATGGATTTTAGTTGTATATTGGTTTATGTATTTTTCTTAAGTATACA

GTGCACTGTTTGAAATGTATTGTTGAGTATTACTTTGTACAGGTTGATCACTTTTTTTAGAGTGAAGAAAGAACAAACTTGGGTTTTTTTTGTGTTTTTT

TTAAAGGAGTATAAAATAATGAAGGATGTATAATTGATGCCAAATAAGCTTGTTCTTTAGTCACGATGACGTCTTGTTTTTCCCTCTAGGCCAGTTCTGT

TTCTAAGGTGTACAAGGACCATGTTACAGTGTAAGAAACTCCACATCCGTGTGTTCCCATTCGCATTTTGTATCGGTTCATGTATACCATTTTTACAAAA

AGAAAAAAGAAAAAAAAAGAAGTACTATAAAATATCTGTCTTCTTAATAAAAAAATTAATGTTACAAGTGA
Translation
GDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRP - UNI18862 - PLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQL

YTDPPQESYTTITVLV - UNI8419 - VPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKG GKSEVEEWSDMYTVTSQLMLKVH

KEDDGVPVICQVEHPAVTGNLQTQRYLEVQY YKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQ QPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKT

DNGTYRCEASNIVGKAHSDYMLYVYD DPPTTIPPPTTTTTTTTTTTTTILTIITD DTTATTEPAVHD DSRAGEEGTIGAVDHAVIGGVVAVVVFAML

CLLIILGRYFARHKG GTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
Transcript ENSMUST00000085909
Sequence
GTGCCACGATTGGTCGCTCCTGACTCCGCCTCCAGCGCATCTCATTAGCATCTCATTAGCTGTCCGCTCGGGCTCGGGAGGCAGCCACCGCCGCCAGTCT

GAGGCAGGTGCCCGACATGGCGAGTGCTGTGCTGCCGAGCGGATCCCAGTGTGCGGCGGCAGCGGCTGTGGCGGCGGCGGCGGCGCCTCCAGGGCTCCGG

CTCCGGCTCCTGCTGTTGCTCCTTTCGGCCGCGGCACTGATCCCCACAG - UNI4028 - - UNI14535 - - UNI18862 - GTGATGGACAGA

ATCTGTTTACTAAAGACGTGACAGTGATTGAAGGAGAAGTGGCAACCATCAGCTGCCAGGTCAATAAGAGTGACGACTCAGTGATCCAGCTCCTGAACCC

CAACAGGCAGACCATTTACTTCAGGGACTTCAGGC - UNI18862 - CTTTGAAGGACAGCAGGTTTCAGCTGCTGAATTTTTCTAGCAGTGAACTCA

AAGTGTCACTGACGAATGTCTCAATCTCGGATGAAGGGAGATACTTCTGCCAGCTCTACACGGACCCCCCACAGGAGAGTTACACCACCATCACAGTCCT

GG - UNI8419 - TTCCTCCACGTAACTTGATGATCGATATCCAGAAAGACACGGCAGTTGAAGGGGAGGAGATTGAAGTCAACTGTACTGCCATGGC

CAGCAAGCCAGCGACGACCATCAGGTGGTTCAAAGGGAACAAGGAACTCAAAG GCAAATCAGAGGTGGAGGAGTGGTCGGACATGTACACTGTGACCAG

TCAGCTGATGCTGAAGGTGCACAAGGAGGACGACGGGGTCCCGGTGATCTGCCAGGTGGAGCACCCTGCGGTCACTGGAAACCTGCAGACCCAGCGCTAT

CTAGAAGTGCAGT ATAAACCGCAAGTGCATATCCAGATGACTTACCCTCTGCAAGGCCTAACCCGGGAAGGGGATGCATTTGAGTTAACGTGTGAAGCC

ATCGGGAAGCCCCA GCCTGTGATGGTAACTTGGGTGAGAGTCGATGATGAAATGCCTCAACATGCCGTACTGTCTGGGCCAAACCTGTTCATCAATAAC

CTAAACAAAACAGATAACGGTACTTACCGCTGTGAGGCTTCCAACATAGTGGGAAAGGCTCATTCGGACTATATGCTGTATGTATACG ATCCCCCCACA

ACTATCCCTCCTCCCACAACAACCACCACCACTACCACCACCACCACCACCACCATCCTTACCATCATCACAG ACACCACGGCGACGACAGAACCAGCA

GTTCACG ATTCTCGAGCAGGTGAAGAGGGGACCATTGGGGCAGTGGACCACGCAGTGATTGGTGGCGTCGTAGCCGTGGTGGTGTTTGCCATGCTATGC

TTGCTCATCATTCTGGGCCGCTATTTTGCCAGACATAAAG GTACATACTTCACTCATGAAGCCAAAGGAGCCGATGACGCAGCAGACGCAGACACAGCT

ATAATCAATGCAGAAGGAGGACAGAACAACTCCGAAGAAAAGAAAGAGTACTTCATCTAGATCAGCCTTTTTGTTCCAATGAGGTGTCCAACTGGCCTGT

TTAGATGATAAAGAGACAGTGATACTGGAACTTTCGAGAAGCTCGTGTGGTTTTTTGTTTTGTTTTGTTTTTTTATGAGTGGGTGGAGAGATGCGAGACT

GGGAAGGCTTGGGATTTGCAATGTACAAACAAAAACAAAGAATGTTCTTTGAAAGTACACTCTGCTGTTTGACACCTCTTTTTAATCTGGTTTTAATTTG

CTTTGGGTTTTGGGTTTTTTTGGTTTTTTGTTTTTTTCATTTATATTTCTTCCTACCAAGTCAAACTTGGGTACTTGGATTTGGTTTCGGTAGATTGCAG

AAAATTCTGTGCCTTGTTTTTCATTCGTTTGTTGTGTTTCTTCCCTCTTGCCCATTTATTTTTCCCAAAATCAAATTTGTTTTTTTCCCCCTCCCAAACC

TCCCATTTTTTGGAATTGACCTGCTGGAATTCCTAAGACTTTCTCCCTGTTGCCAGTTTCTTTTATTTGTGTTAACGGTGACTGCTTTCTGTTCCAAATT

CAGTTTCATAAAAGGAAAACCAGCACAATTTAGATTTCATAGTTCAGAATTTAGTGTCTCCATGATGCATCCTTCTCTGTTGTTGTAAAGATTTGGGTG
Translation
MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTG - UNI4028 - - UNI14535 - - UNI18862 - GDGQNLFTKDVTVIEG

EVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRP - UNI18862 - PLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLV

 - UNI8419 - VPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKG GKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPA

VTGNLQTQRYLEVQY YKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQ QPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKA

HSDYMLYVYD DPPTTIPPPTTTTTTTTTTTTTILTIITD DTTATTEPAVHD DSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKG 

GTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
Transcript ENSMUST00000114548
Sequence
GGCGCGGGCGCGCGGCCGAACGCTAGCGCCAGGGGGCGGGGTGGGGGAGGGGGCTAGTTCTCGGAGAGCCGGGTTGGGCTCGAGGTGCCACGATTGGTCG

CTCCTGACTCCGCCTCCAGCGCATCTCATTAGCATCTCATTAGCTGTCCGCTCGGGCTCGGGAGGCAGCCACCGCCGCCAGTCTGAGGCAGGTGCCCGAC

ATGGCGAGTGCTGTGCTGCCGAGCGGATCCCAGTGTGCGGCGGCAGCGGCTGTGGCGGCGGCGGCGGCGCCTCCAGGGCTCCGGCTCCGGCTCCTGCTGT

TGCTCCTTTCGGCCGCGGCACTGATCCCCACAG - UNI4028 - - UNI14535 - - UNI18862 - GTGATGGACAGAATCTGTTTACTAAAGA

CGTGACAGTGATTGAAGGAGAAGTGGCAACCATCAGCTGCCAGGTCAATAAGAGTGACGACTCAGTGATCCAGCTCCTGAACCCCAACAGGCAGACCATT

TACTTCAGGGACTTCAGGC - UNI18862 - CTTTGAAGGACAGCAGGTTTCAGCTGCTGAATTTTTCTAGCAGTGAACTCAAAGTGTCACTGACGAA

TGTCTCAATCTCGGATGAAGGGAGATACTTCTGCCAGCTCTACACGGACCCCCCACAGGAGAGTTACACCACCATCACAGTCCTGG - UNI8419 - T

TCCTCCACGTAACTTGATGATCGATATCCAGAAAGACACGGCAGTTGAAGGGGAGGAGATTGAAGTCAACTGTACTGCCATGGCCAGCAAGCCAGCGACG

ACCATCAGGTGGTTCAAAGGGAACAAGGAACTCAAAG GCAAATCAGAGGTGGAGGAGTGGTCGGACATGTACACTGTGACCAGTCAGCTGATGCTGAAG

GTGCACAAGGAGGACGACGGGGTCCCGGTGATCTGCCAGGTGGAGCACCCTGCGGTCACTGGAAACCTGCAGACCCAGCGCTATCTAGAAGTGCAGT AT

AAACCGCAAGTGCATATCCAGATGACTTACCCTCTGCAAGGCCTAACCCGGGAAGGGGATGCATTTGAGTTAACGTGTGAAGCCATCGGGAAGCCCCA G

CCTGTGATGGTAACTTGGGTGAGAGTCGATGATGAAATGCCTCAACATGCCGTACTGTCTGGGCCAAACCTGTTCATCAATAACCTAAACAAAACAGATA

ACGGTACTTACCGCTGTGAGGCTTCCAACATAGTGGGAAAGGCTCATTCGGACTATATGCTGTATGTATACG ACACCACGGCGACGACAGAACCAGCAG

TTCACG ATTCTCGAGCAGGTGAAGAGGGGACCATTGGGGCAGTGGACCACGCAGTGATTGGTGGCGTCGTAGCCGTGGTGGTGTTTGCCATGCTATGCT

TGCTCATCATTCTGGGCCGCTATTTTGCCAGACATAAAG GTACATACTTCACTCATGAAGCCAAAGGAGCCGATGACGCAGCAGACGCAGACACAGCTA

TAATCAATGCAGAAGGAGGACAGAACAACTCCGAAGAAAAGAAAGAGTACTTCATCTAGATCAGCCTTTTTGTTCCAATGAGGTGTCCAACTGGCCTGTT

TAGATGATAAAGAGACAGTGATACTGGAACTTTCGAGAAGCTCGTGTGGTTTTTTGTTTTGTTTTGTTTTTTTATGAGTGGGTGGAGAGATGCGAGACTG

GGAAGGCTTGGGATTTGCAATGTACAAACAAAAACAAAGAATGTTCTTTGAAAGTACACTCTGCTGTTTGACACCTCTTTTTAATCTGGTTTTAATTTGC

TTTGGGTTTTGGGTTTTTTTGGTTTTTTGTTTTTTTCATTTATATTTCTTCCTACCAAGTCAAACTTGGGTACTTGGATTTGGTTTCGGTAGATTGCAGA

AAATTCTGTGCCTTGTTTTTCATTCGTTTGTTGTGTTTCTTCCCTCTTGCCCATTTATTTTTCCCAAAATCAAATTTGTTTTTTTCCCCCTCCCAAACCT

CCCATTTTTTGGAATTGACCTGCTGGAATTCCTAAGACTTTCTCCCTGTTGCCAGTTTCTTTTATTTGTGTTAACGGTGACTGCTTTCTGTTCCAAATTC

AGTTTCATAAAAGGAAAACCAGCACAATTTAGATTTCATAGTTCAGAATTTAGTGTCTCCATGATGCATCCTTCTCTGTTGTTGTAAAGATTTGGGTGAA

GAAAAAAAAAAAAAAAGAAAAAAAAAAGAAAAAAAAAAGAAAACACTGAAAACTCTTTGCTGCTGCCCATGTCTTAAATACGTAGAGCAGCGAAGACTAG

AAACGTAGACTGTGACCCAGACGCTGTCGTCTGCTGTGGATCTTCATTACTGTACAGGGTTATCTGCAAGTGAGGTGTGTCGCAATGAGATTGAATCTGT

CGTTAATTCTTTATCTGTAGGCGGCTCAGTATAGATTACCCCACGCTGTGCAGAAAGTTTTTGGAGTGGAAAGGTCTCCTCCTTCCTCGTTGCCCTAAAC

AGACCCGACATGTGAGGTCTGTCTGTTTTATGTAAGTGGACAAATTTGAGATGTCACAGGAGGGGAAGCAGGGAGGGGGTACGACAGTTCTGCTCTGATT

ATTTCTACTCTCAACAATTCCATCCACCTTTCCCAATTGGCCTTACTGCTCACTAATGCAGGAGAGAGCAAGTCCGTGTGCCGTGTGACTGACTGGAGGG

GACAGGCTTTGTTTAGGTTTTTTTTACCCCCACTTTGGTTTTGGTTCTGGGTTGTTTTGCTTTGTTTTGTTTTCCTTTGTTCTTATTAAGGACGGCAGTG

GGCTGTGTCCTGTGTGTACTGTATGTTACAGACACCGTCCTGCTGGGACACTTGTCCTGCTGGGATTCCCAGCTCCCACCCCCAACTCCTCTCATTCCTT

CAGATTTGGCTTGACAAAGGCAGGAGGTACAAAAGAAGGGCCAATTTTGTTCTGGAAAGGTCAGAGCCCAGAGTCGAGGTGGGAAAGTGGCATATAGGGA

TTTCCAGTTACTTAATCAAAACTCAAAATGTGAGTGTTTCTGTCTTTCGTGCACTAGGCCTGGCCTCTTACCTCAGCCTTAAGAACCATCTGCCAAAAAC

TACTCATCTCGCATGATGGCAGCCAGAGCGCATAGCTACTAAAATAAGTTTCCGTGAACATATCTTACACCGGAGCCTGAGGAAAGATAGAGGCGCAAAG

GAACCCTTTGCATTCTCTAAAGCTAAGTGGGGGTTTGCAGAAGTGCTGGGGTCATCTAGCAGTAGTTCTGAAGGACAGAACCTAAACTCTTACCACACGT

GTCGGTAAGCTCCAGACTCCAAAACAGCCCCTCTGGAAAGATGGCATCAGAAAAGATAGATCTATCTATATATATAAATATATAAATATATATTATATAT

AACATTTTCAGTCAGTACTTTTGGATTTTGCAAGGTGCATTTTTACTATTGTTACATTATGTGGAAAACCTACGCTGATTTATTTAAGGGGAAAAAAGTG

TCGACTCTGTTCTTTGAAAGCGTATTTCTTTTTCTTGTCTTTATTTTAACTTCTGATAGAACCACTGCAATATGGGGGCCTTTTGGGAACGGACTGGTTT

GTAAAGGAAAATTCATTATGGAGCAGTGTTTTGTTAACCCCTCTCCTGCCCCTAGGCACTTAACCAAGACAAAAAGCCACAAGGAACATCCCTTTTTCAA

AAATTTTATAATGTGCATCTATTCCGAGCCCTTAGCACCCATCCTGACCATAGTGACCATATCAAAGGGTGACAACCAGTTAGCATGTCGTTGAAAGGGT

TTTTCAGCTGTTCTTTTTAGAAAAAAAATATATATAAAAAATATTTAAAAAAAAACAAAAAACAAACAAACACAAAAAAACTACCATTGTTCACAGAATT

GGCATCTCATTTTCGGGACCGCCCATCTTTCTGTTTTGACAAGTGTACAGTAGTGCAGTGTTCTGATGTAACTTTATGGCTTACAATGTTGACATGTCTC

AGGTTCCTGTGTTTCAATTGGTGTTTTTCCGTCTCAGGTAGATTGCAAAGTGTAGGCCCCACACATTGGAAAAATAATAATAATAATAAATAATAATAAT

AATAATAATAATAAAACAAAGCAAAAACAGGAAATTATGGATTTTAGTTGTATATTGGTTTATGTATTTTTCTTAAGTATACAGTGCACTGTTTGAAATG

TATTGTTGAGTATTACTTTGTACAGGTTGATCACTTTTTTTAGAGTGAAGAAAGAACAAACTTGGGTTTTTTTTGTGTTTTTTTTAAAGGAGTATAAAAT

AATGAAGGATGTATAATTGATGCCAAATAAGCTTGTTCTTTAGTCACGATGACGTCTTGTTTTTCCCTCTAGGCCAGTTCTGTTTCTAAGGTGTACAAGG

ACCATGTTACAGTGTAAGAAACTCCACATCCGTGTGTTCCCATTCGCATTTTGTATCGGTTCATGTATACCATTTTTACAAAAAGAAAAAAGAAAAAAAA

AGAAGTACTATAAAATATCTGTCTTCTTAATAAAAAAATTAATGTTACAAGTGA
Translation
MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTG - UNI4028 - - UNI14535 - - UNI18862 - GDGQNLFTKDVTVIEG

EVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRP - UNI18862 - PLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLV

 - UNI8419 - VPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKG GKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPA

VTGNLQTQRYLEVQY YKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQ QPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKA

HSDYMLYVYD DTTATTEPAVHD DSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKG GTYFTHEAKGADDAADADTAIINAEGGQNN

SEEKKEYFI
Transcript ENSMUST00000034581
Sequence
ATGGCGAGTGCTGTGCTGCCGAGCGGATCCCAGTGTGCGGCGGCAGCGGCTGTGGCGGCGGCGGCGGCGCCTCCAGGGCTCCGGCTCCGGCTCCTGCTGT

TGCTCCTTTCGGCCGCGGCACTGATCCCCACAG - UNI4028 - - UNI14535 - - UNI18862 - GTGATGGACAGAATCTGTTTACTAAAGA

CGTGACAGTGATTGAAGGAGAAGTGGCAACCATCAGCTGCCAGGTCAATAAGAGTGACGACTCAGTGATCCAGCTCCTGAACCCCAACAGGCAGACCATT

TACTTCAGGGACTTCAGGC - UNI18862 - CTTTGAAGGACAGCAGGTTTCAGCTGCTGAATTTTTCTAGCAGTGAACTCAAAGTGTCACTGACGAA

TGTCTCAATCTCGGATGAAGGGAGATACTTCTGCCAGCTCTACACGGACCCCCCACAGGAGAGTTACACCACCATCACAGTCCTGG - UNI8419 - T

TCCTCCACGTAACTTGATGATCGATATCCAGAAAGACACGGCAGTTGAAGGGGAGGAGATTGAAGTCAACTGTACTGCCATGGCCAGCAAGCCAGCGACG

ACCATCAGGTGGTTCAAAGGGAACAAGGAACTCAAAG GCAAATCAGAGGTGGAGGAGTGGTCGGACATGTACACTGTGACCAGTCAGCTGATGCTGAAG

GTGCACAAGGAGGACGACGGGGTCCCGGTGATCTGCCAGGTGGAGCACCCTGCGGTCACTGGAAACCTGCAGACCCAGCGCTATCTAGAAGTGCAGT AT

AAACCGCAAGTGCATATCCAGATGACTTACCCTCTGCAAGGCCTAACCCGGGAAGGGGATGCATTTGAGTTAACGTGTGAAGCCATCGGGAAGCCCCA G

CCTGTGATGGTAACTTGGGTGAGAGTCGATGATGAAATGCCTCAACATGCCGTACTGTCTGGGCCAAACCTGTTCATCAATAACCTAAACAAAACAGATA

ACGGTACTTACCGCTGTGAGGCTTCCAACATAGTGGGAAAGGCTCATTCGGACTATATGCTGTATGTATACG ATTCTCGAGCAGGTGAAGAGGGGACCA

TTGGGGCAGTGGACCACGCAGTGATTGGTGGCGTCGTAGCCGTGGTGGTGTTTGCCATGCTATGCTTGCTCATCATTCTGGGCCGCTATTTTGCCAGACA

TAAAG GTACATACTTCACTCATGAAGCCAAAGGAGCCGATGACGCAGCAGACGCAGACACAGCTATAATCAATGCAGAAGGAGGACAGAACAACTCCGA

AGAAAAGAAAGAGTACTTCATCTAG
Translation
MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTG - UNI4028 - - UNI14535 - - UNI18862 - GDGQNLFTKDVTVIEG

EVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRP - UNI18862 - PLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLV

 - UNI8419 - VPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKG GKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPA

VTGNLQTQRYLEVQY YKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQ QPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKA

HSDYMLYVYD DSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKG GTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
Transcript ENSMUST00000114547
Sequence
GTGCCACGATTGGTCGCTCCTGACTCCGCCTCCAGCGCATCTCATTAGCATCTCATTAGCTGTCCGCTCGGGCTCGGGAGGCAGCCACCGCCGCCAGTCT

GAGGCAGGTGCCCGACATGGCGAGTGCTGTGCTGCCGAGCGGATCCCAGTGTGCGGCGGCAGCGGCTGTGGCGGCGGCGGCGGCGCCTCCAGGGCTCCGG

CTCCGGCTCCTGCTGTTGCTCCTTTCGGCCGCGGCACTGATCCCCACAG - UNI4028 - - UNI14535 - - UNI18862 - GTGATGGACAGA

ATCTGTTTACTAAAGACGTGACAGTGATTGAAGGAGAAGTGGCAACCATCAGCTGCCAGGTCAATAAGAGTGACGACTCAGTGATCCAGCTCCTGAACCC

CAACAGGCAGACCATTTACTTCAGGGACTTCAGGC - UNI18862 - CTTTGAAGGACAGCAGGTTTCAGCTGCTGAATTTTTCTAGCAGTGAACTCA

AAGTGTCACTGACGAATGTCTCAATCTCGGATGAAGGGAGATACTTCTGCCAGCTCTACACGGACCCCCCACAGGAGAGTTACACCACCATCACAGTCCT

GG - UNI8419 - TTCCTCCACGTAACTTGATGATCGATATCCAGAAAGACACGGCAGTTGAAGGGGAGGAGATTGAAGTCAACTGTACTGCCATGGC

CAGCAAGCCAGCGACGACCATCAGGTGGTTCAAAGGGAACAAGGAACTCAAAG GCAAATCAGAGGTGGAGGAGTGGTCGGACATGTACACTGTGACCAG

TCAGCTGATGCTGAAGGTGCACAAGGAGGACGACGGGGTCCCGGTGATCTGCCAGGTGGAGCACCCTGCGGTCACTGGAAACCTGCAGACCCAGCGCTAT

CTAGAAGTGCAGT ATAAACCGCAAGTGCATATCCAGATGACTTACCCTCTGCAAGGCCTAACCCGGGAAGGGGATGCATTTGAGTTAACGTGTGAAGCC

ATCGGGAAGCCCCA GCCTGTGATGGTAACTTGGGTGAGAGTCGATGATGAAATGCCTCAACATGCCGTACTGTCTGGGCCAAACCTGTTCATCAATAAC

CTAAACAAAACAGATAACGGTACTTACCGCTGTGAGGCTTCCAACATAGTGGGAAAGGCTCATTCGGACTATATGCTGTATGTATACG ATCCCCCCACA

ACTATCCCTCCTCCCACAACAACCACCACCACTACCACCACCACCACCACCACCATCCTTACCATCATCACAG ATTCTCGAGCAGGTGAAGAGGGGACC

ATTGGGGCAGTGGACCACGCAGTGATTGGTGGCGTCGTAGCCGTGGTGGTGTTTGCCATGCTATGCTTGCTCATCATTCTGGGCCGCTATTTTGCCAGAC

ATAAAG GTACATACTTCACTCATGAAGCCAAAGGAGCCGATGACGCAGCAGACGCAGACACAGCTATAATCAATGCAGAAGGAGGACAGAACAACTCCG

AAGAAAAGAAAGAGTACTTCATCTAGATCAGCCTTTTTGTTCCAATGAGGTGTCCAACTGGCCTGTTTAGATGATAAAGAGACAGTGATACTGGAACTTT

CGAGAAGCTCGTGTGGTTTTTTGTTTTGTTTTGTTTTTTTATGAGTGGGTGGAGAGATGCGAGACTGGGAAGGCTTGGGATTTGCAATGTACAAACAAAA

ACAAAGAATGTTCTTTGAAAGTACACTCTGCTGTTTGACACCTCTTTTTAATCTGGTTTTAATTTGCTTTGGGTTTTGGGTTTTTTTGGTTTTTTGTTTT

TTTCATTTATATTTCTTCCTACCAAGTCAAACTTGGGTACTTGGATTTGGTTTCGGTAGATTGCAGAAAATTCTGTGCCTTGTTTTTCATTCGTTTGTTG

TGTTTCTTCCCTCTTGCCCATTTATTTTTCCCAAAATCAAATTTGTTTTTTTCCCCCTCCCAAACCTCCCATTTTTTGGAATTGACCTGCTGGAATTCCT

AAGACTTTCTCCCTGTTGCCAGTTTCTTTTATTTGTGTTAACGGTGACTGCTTTCTGTTCCAAATTCAGTTTCATAAAAGGAAAACCAGCACAATTTAGA

TTTCATAGTTCAGAATTTAGTGTCTCCATGATGCATCCTTCTCTGTTGTTGTAAAGATTTGGGTGAAGAAAAAAAAAAAAAAAGAAAAAAAAAAGAAAAA

AAAAAGAAAACACTGAAAACTCTTTGCTGCTGCCCATGTCTTAAATACGTAGAGCAGCGAAGACTAGAAACGTAGACTGTGACCCAGACGCTGTCGTCTG

CTGTGGATCTTCATTACTGTACAGGGTTATCTGCAAGTGAGGTGTGTCGCAATGAGATTGAATCTGTCGTTAATTCTTTATCTGTAGGCGGCTCAGTATA

GATTACCCCACGCTGTGCAGAAAGTTTTTGGAGTGGAAAGGTCTCCTCCTTCCTCGTTGCCCTAAACAGACCCGACATGTGAGGTCTGTCTGTTTTATGT

AAGTGGACAAATTTGAGATGTCACAGGAGGGGAAGCAGGGAGGGGGTACGACAGTTCTGCTCTGATTATTTCTACTCTCAACAATTCCATCCACCTTTCC

CAATTGGCCTTACTGCTCACTAATGCAGGAGAGAGCAAGTCCGTGTGCCGTGTGACTGACTGGAGGGGACAGGCTTTGTTTAGGTTTTTTTTACCCCCAC

TTTGGTTTTGGTTCTGGGTTGTTTTGCTTTGTTTTGTTTTCCTTTGTTCTTATTAAGGACGGCAGTGGGCTGTGTCCTGTGTGTACTGTATGTTACAGAC

ACCGTCCTGCTGGGACACTTGTCCTGCTGGGATTCCCAGCTCCCACCCCCAACTCCTCTCATTCCTTCAGATTTGGCTTGACAAAGGCAGGAGGTACAAA

AGAAGGGCCAATTTTGTTCTGGAAAGGTCAGAGCCCAGAGTCGAGGTGGGAAAGTGGCATATAGGGATTTCCAGTTACTTAATCAAAACTCAAAATGTGA

GTGTTTCTGTCTTTCGTGCACTAGGCCTGGCCTCTTACCTCAGCCTTAAGAACCATCTGCCAAAAACTACTCATCTCGCATGATGGCAGCCAGAGCGCAT

AGCTACTAAAATAAGTTTCCGTGAACATATCTTACACCGGAGCCTGAGGAAAGATAGAGGCGCAAAGGAACCCTTTGCATTCTCTAAAGCTAAGTGGGGG

TTTGCAGAAGTGCTGGGGTCATCTAGCAGTAGTTCTGAAGGACAGAACCTAAACTCTTACCACACGTGTCGGTAAGCTCCAGACTCCAAAACAGCCCCTC

TGGAAAGATGGCATCAGAAAAGATAGATCTATCTATATATATAAATATATAAATATATATTATATATAACATTTTCAGTCAGTACTTTTGGATTTTGCAA

GGTGCATTTTTACTATTGTTACATTATGTGGAAAACCTACGCTGATTTATTTAAGGGGAAAAAAGTGTCGACTCTGTTCTTTGAAAGCGTATTTCTTTTT

CTTGTCTTTATTTTAACTTCTGATAGAACCACTGCAATATGGGGGCCTTTTGGGAACGGACTGGTTTGTAAAGGAAAATTCATTATGGAGCAGTGTTTTG

TTAACCCCTCTCCTGCCCCTAGGCACTTAACCAAGACAAAAAGCCACAAGGAACATCCCTTTTTCAAAAATTTTATAATGTGCATCTATTCCGAGCCCTT

AGCACCCATCCTGACCATAGTGACCATATCAAAGGGTGACAACCAGTTAGCATGTCGTTGAAAGGGTTTTTCAGCTGTTCTTTTTAGAAAAAAAATATAT

ATAAAAAATATTTAAAAAAAAACAAAAAACAAACAAACACAAAAAAACTACCATTGTTCACAGAATTGGCATCTCATTTTCGGGACCGCCCATCTTTCTG

TTTTGACAAGTGTACAGTAGTGCAGTGTTCTGATGTAACTTTATGGCTTACAATGTTGACATGTCTCAGGTTCCTGTGTTTCAATTGGTGTTTTTCCGTC

TCAGGTAGATTGCAAAGTGTAGGCCCCACACATTGGAAAAATAATAATAATAATAAATAATAATAATAATAATAATAATAAAACAAAGCAAAAACAGGAA

ATTATGGATTTTAGTTGTATATTGGTTTATGTATTTTTCTTAAGTATACAGTGCACTGTTTGAAATGTATTGTTGAGTATTACTTTGTACAGGTTGATCA

CTTTTTTTAGAGTGAAGAAAGAACAAACTTGGGTTTTTTTTGTGTTTTTTTTAAAGGAGTATAAAATAATGAAGGATGTATAATTGATGCCAAATAAGCT

TGTTCTTTAGTCACGATGACGTCTTGTTTTTCCCTCTAGGCCAGTTCTGTTTCTAAGGTGTACAAGGACCATGTTACAGTGTAAGAAACTCCACATCCGT

GTGTTCCCATTCGCATTTTGTATCGGTTCATGTATACCATTTTTACAAAAAGAAAAAAGAAAAAAAAAGAAGTACTATAAAATATCTGTCTTCTTAATAA

AAAAATTAATGTTACA
Translation
MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTG - UNI4028 - - UNI14535 - - UNI18862 - GDGQNLFTKDVTVIEG

EVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRP - UNI18862 - PLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLV

 - UNI8419 - VPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKG GKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPA

VTGNLQTQRYLEVQY YKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQ QPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKA

HSDYMLYVYD DPPTTIPPPTTTTTTTTTTTTTILTIITD DSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKG GTYFTHEAKGADD

AADADTAIINAEGGQNNSEEKKEYFI

For any suggestions or comments, please send an email to unitrap@crg.es