Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032096 (Arcn1)
Chromosomal location
Chr 9: 44550224 - 44575896 (-)
Description
archain 1 Gene [Source:MGI (curated);Acc:Arcn1-001]
RefSeq_dna
NM_145985 
RefSeq_peptide
NP_666097.3 
UniGene
Mm.371682 Mm.465568 
MGI
MGI:2387591 
Uniprot/SWISSPROT
Q5XJY5 
Uniprot/SPTREMBL
Q3TDU1 Q3U4S9 Q8C0G7 Q8R1S6 Q91W48 
Human Ortholog
ENSG00000095139 (ARCN1)
Omim not available
UniTrap UNI1630
Vector Insertion
Chr 9: 44568309 - 44575752
Public Clones AY0087 (sanger) YHC439 (baygenomics)
Private Clones OST194628 (lexicon) OST110782 (lexicon) OST41305 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26603
Vector Insertion
Chr 9: 44567144 - 44568044
Public Clones not available
Private Clones OST108292 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9933
Vector Insertion
Chr 9: 44565368 - 44566643
Public Clones XC205 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30958
Vector Insertion
Chr 9: 44560192 - 44565368
Public Clones IST12814C1 (tigm) IST12340B6 (tigm) IST10261A9 (tigm) IST12814D1 (tigm)
IST13236A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11912
Vector Insertion
Chr 9: 44558517 - 44559298
Public Clones Q020E02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034607
Sequence
ATCTTGGCAAGAGGCGAAGCGGCGGAGGCTCCTGTCAGGGGCGGCAGGTCCGGAGCGGCCAGAGCTCCGCGTCTCTGGGCAGCAGCCCGAGTCCCCGCAG

AGCCAGAGCGCGGCGCAGCGCGCCCCACCTGCGGCCTCACCATG - UNI1630 - GTGCTGTTGGCAGCAGCAGTCTGCACGAAAGCGGGAAAGGCTA

TTGTTTCTCGACAGTTCGTGGAGATGACCCGAACTCGGATTGAAGGCTTATTAGCAGCTTTCCCAAAACTCATGAACACTGGAAAACAACATACTTTTGT

TGAAACAGAGAGTGTAAGATATGTGTACCAACCTATGGAGAAACTGTACATGGTATTGATCACTACAAAGAACAGCAATATCTTAGAAGATTTGGAGACT

TTAAGGCTCTTCTCAAGGGTG - UNI26603 - ATCCCTGAATATTGCCGAGCCTTAGAGGAAAATGAAATATCTGAGCACTGTTTTGATTTGATTTT

TGCTTTTGATGAAATTGTTGCCCTGGGATACCGGGAGAATGTTAACCTGGCACAGATCAGAACCTTTACAGAAATGGACTCTCACGAGGAGAAAGTATTC

CGAGCAGTCAGAGAG ACTCAAGAACGTGAGGCTAAGGCTGAGATGCGGCGTAAAGCAAAGGAATTACAACAGGCCCGAAGAGATGCAGAGAGACAGGGG

AAAAAAGCACCAGGATTTGGCGGATTTGGTAGTTCTGCAGTGTCTGGAGGCAGCACAGCAGCCATGATCACAGAGACTATCATTGAAACTGATAAACCAA

AAGTGGCGCCTGCACCAGCCAG - UNI9933 - - UNI30958 - ACCTTCAGGCCCCAGCAAGGCTTTGAAACTTGGAGCTAAAGGAAAGGAAGTA

GATAACTTTGTGGACAAATTGAAATCTGAAGGTGAAACTATTATGTCTTCTAATATGGGAAAACGTACCTCAGAAGCAACCAAAGTGCATGCTCCACCTA

TTAATATGGAAAG - UNI30958 - TGTGCACATGAAGATTGAAGAGAAGATCACACTAACCTGTGGGAGAGATGGAGGATTACAGAATATGGAGTTG

CATGGCATGATCATGCTTAGGATCTCAGATGACAAATTTGGCCGGATTCGTCTTCATGTAGAAAATGAAGATAAGAAAGGGGTGCAGCTACAG - UNI3

0958 - ACGCATCCAAATGTGGATAAAAAACTTTTTACTGCAGAGTCTCTCATTGGCTTGAAAAACCCAGAGAAGTCATTTCCAGTCAACAGTGATGTA

GGGGTACTAAAGTGGAGACTACAAACAACAGAGGAATCTTTTATTCCGTTGACAA - UNI11912 - TTAATTGCTGGCCTTCGGAAAGTGGAAATGG

CTGTGATGTCAACATAGAGTACGAACTACAGGAAGATAATTTAGAGCTCAATGATGTGGTCATCACTATCCCACTCCC ATCGGGTGTTGGCGCGCCTGT

GATTGGTGAGATCGATGGGGAATATCGACATGACAGTCGGAGAAATACGTTGGAGTGGTGCCTGCCAGTGATTGATGCCAAAAATAAGAGTGGCAGCCTG

GAGTTCAGCATTCCTGGGCAGCCTAATGACTTCTTCCCTGTTCAAGTTTCTTTCATCTCCAAAAAGAATTACTGCAACATACAG GTTACCAAAGTGACC

CAGGTGGATGGAAACAGCCCCGTCAGGTTTTCCACGGAGACCACTTTCTTAGTGGACAAATACGAAATCCTGTAATACCAAGAAGGGAAAGCTGAAAAGG

AAGGATTTCAGATTAATAAAGAAGAAGCCAAAAGTGGCTGAAGAGTTTTCCAAATTTACAAGCCATTGGAGGTCCCCCAACCCCCTTTTCTGATACAGTG

CACGTTCTCTGCGCGCAAGGACCCTCAACTCACACCCAGTGTTGCGGTGTCACAGAGACATTTTTGACAAATGACACTGACATAAAGGGAAAGGCTGCTG

ATTTCTTTGGCCAGCAGGAAGCCAGCTCTCCAGGGAATGGAATGCCCCAGTAAATAGCTCTTCTGCCTTCACCTAAGTCTTCCTTTATTTTAAGCCCTAA

ATATAGGTATATTTCATACTTTGTTTTAAAAAGTTTTCTCTATGGATTTGAGTCTTTCACACCCCTTTGCTTTCTGTTTTCTTTCAGTACACTTAGTCAC

ACACTGGGGTCATCTGTCTGTTGTACTGTGTTCAGCACTCTGAGAACAAGGTTATCTAACCCATTCTTGACATTAGACAGTACCAGTGAACTGCTTAAGG

GATGTAGAGTCTAGAAGTTGAAATACAAGGTTGTCTTGTTTTCTCTCCTGTATCCATCCATTGCTCCATCTCTTTATGAAGTCGTCCTTGTGAGCCCTGC

CCTTCCAGTTGCAGGCAGTGTTGTGAATCCCATTTGTGTCAATATTAAAGGTAGCCAGCTGGGAAGCAGCTTTTATGTGTACACACCTTTTCAAGATGCC

GAATAAGATGGCTACATCCATTTCCACAGGAAATCATGTCTGCTGCTAATGCTACCCCAACTTACAGTTCCCTACTTGACTTATGGTTCCCTACGTAACT

TACAGTTCTCTCCGTGCTGTGGGGCGATTGAGTTGAAGCACGTAGTCCACTCAGATTCCGCGTGTCCACCTCCTCCCTTCCCAGATGCTTTTCCCTTCAT

CAGTCTTCTTTCCAGCAGAAATGAGTCTAGTGAGTCTGTGCCATTTCTCATTAGCCCTAAATCACTGGAGAGATCCATCTTTACCATTTCAGTGGTAGCA

TTTTGAGAGGTGTATAGTGAGGGGTTACTCAAATATACCCCATCTAACCTGACATTTACCACCTCCCTCTCTGTCCTTGTTTCTGAAAACCTTTTTTTCT

CCTCCTCAGGCTTTTTGGTGTCATCATGTAATAATTGTAGGAGTTCTCAGCTCATTTTGATCTATTACCTTTTCAATAGAGGCTGAATCAGCCAATCCCA

CCCGCCAAGCACTGAACTGGGCGGGATGGACGATCAGTTGCTGAAGGCTGCAAGCAGTAGCAATGGGAAACAGTAGATGACCTCCATTCTCTCAGGTGGC

TGCAGAGCAGAGCAGAGCAGAGATCTCCCTCTGAACACCTGCCTTCCCTGGCAAGAGTATACTATCCATGAAGCAGGGCAGTCCCACAGAAGACTGTGGC

TGGGATGGCTTGCCAAAGAAATTTCTAGCCTTTCCCTTTCCCCTAAACTGCATCAGGGAAGAATCCTTATCTCTAGCTTCGTTTTCACATGAGGTTTTCT

GAGGAAGGGGACTGGGATAGGAAGTCTGTCATGTAGTAAAGTAGACGAGAAATCTTATTAATCCAGTTGTATTTCAGAGTTTGTCCCTATGATTTTTAAA

GTCAAGTTTAATTTCACAAGACTTTTTTTCTGAAATTACTTTTGGGGTAATATTTAAAATGAGAGACATTTTGTAACCCTGTAAAATACATAGGGAATAT

AACATTCCAATGTACACAACGAAGGCAAATTCTTAATCAAATAAAAGAGTATTATAAAATG
Translation
M - UNI1630 - VLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQPMEKLYMVLITTKNSNILEDLETLRLFS

RV - UNI26603 - IPEYCRALEENEISEHCFDLIFAFDEIVALGYRENVNLAQIRTFTEMDSHEEKVFRAVRE TQEREAKAEMRRKAKELQQARRD

AERQGKKAPGFGGFGSSAVSGGSTAAMITETIIETDKPKVAPAPAR - UNI9933 - - UNI30958 - RPSGPSKALKLGAKGKEVDNFVDKLKSE

GETIMSSNMGKRTSEATKVHAPPINMES - UNI30958 - SVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKFGRIRLHVENEDKKGVQLQ -

 UNI30958 - THPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTI - UNI11912 - INCWPSESGNGCDVNIEYELQEDN

LELNDVVITIPLP PSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIPGQPNDFFPVQVSFISKKNYCNIQ VTKVTQVDGNSPVRFS

TETTFLVDKYEIL

For any suggestions or comments, please send an email to unitrap@crg.es