Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032097 (Ddx6)
Chromosomal location
Chr 9: 44412979 - 44446427 (+)
Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 Gene [Source:MGI Symbol;Acc:MGI:104976]
RefSeq_dna
NM_007841 NM_181324 
RefSeq_peptide
NP_001104296.1 NP_031867.1 NP_851841.2 
UniGene
Mm.267061 Mm.470466 
MGI
MGI:104976 
Uniprot/SWISSPROT
P54823 
Human Ortholog
ENSG00000110367 (DDX6)
Omim not available
UniTrap UNI15377
Vector Insertion
Chr 9: 44413036 - 44415205
Public Clones (sanger) P141D11 (ggtc) D149A02 (ggtc) P128F04 (ggtc) D072H03 (ggtc)
P149H05 (ggtc) P099F12 (ggtc) P128F09 (ggtc) D148A03 (ggtc) P121E03 (ggtc)
D008C03 (ggtc) H010B04 (ggtc) P104H07 (ggtc) D007D08 (ggtc) CMHD-GT_545B12-5S (cmhd)
CMHD-GT_545B12-3 (cmhd) PST7757-NR (escells) IST11272A5 (tigm) IST13217D10 (tigm)
Private Clones OST466400 (lexicon) OST455751 (lexicon) OST392229 (lexicon) OST390903 (lexicon)
OST340948 (lexicon) OST333178 (lexicon) OST277637 (lexicon) OST250194 (lexicon)
OST247963 (lexicon) OST198988 (lexicon) OST171625 (lexicon) OST149435 (lexicon)
OST140291 (lexicon) OST104038 (lexicon) OST98032 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11972
Vector Insertion
Chr 9: 44415676 - 44420910
Public Clones (sanger) D145G01 (ggtc) M005A03 (ggtc) P013D07 (ggtc) PST10142-NR (escells)
PST17137-NR (escells)
Private Clones OST41435 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4145
Vector Insertion
Chr 9: 44420975 - 44422294
Public Clones AN0164 (sanger) E068H10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4962
Vector Insertion
Chr 9: 44422400 - 44431701
Public Clones AJ0034 (sanger) RRS246 (baygenomics) RRS266 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32124
Vector Insertion
Chr 9: 44438224 - 44439465
Public Clones IST12568E7 (tigm) IST13871D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098836
Sequence
GGGAGCTTCGAGTCAACAATAAAGGACCGAGGGTGCGGAGCGGGAGTGGCCTCGGTG - UNI15377 - ATTGAAGTGAGTGAATTCAGATATAATTC

AAGCTTGTTAGAGGGCTTTAAAAAAAAAAGTTGATTCGGTGCATGAAAGCAAGTTAACTACTGCTGCTCACCGTTGAGAGACTTACAGGTGCTTGCCTGA

ACTGCAATAAAGGACTCATATTATTGAGCAGGACTTATTTATCTCTTCATTTTGGAGAGCCTCATAAACTGTTATTACAGTTTCTCTACTGACTTTGAAA

AGTTTGAAGTTTGGAAGAGACACCTGTGCAGCTAACAAAGCATGAGCACGGCCAGAACAGAGAACCCTGTTATCATGGGTCTGTCCAGTCAGAACGGCCA

GCTGAGGGGCCCTGTGAAGGCCAGTGCTGGCCCTGGAGGAGGGGGCACACAGCCACAGCCACAGCTGAACCAGTTGAAGAACACCAGCACAATCAATAAT

GGCACTCCACAGCAAGCCCAGAGCATGGCCGCCACTATTAA - UNI11972 - ACCTGGTGATGACTGGAAAAAGACATTAAAACTCCCTCCAAAGGA

TCTAAGAATCAAAACTTCG - UNI4145 - GATGTGACCTCCACAAAAGGAAATGAGTTTGAAGATTACTGTTTGAAACGAGAGTTGCTAATGGGAAT

TTTTGAAATGGGCTGGGAAAAACCATCTCCTATCCAG - UNI4962 - GAGGAGAGCATTCCCATTGCTTTATCTGGTAGGGATATCTTAGCTAGAGC

AAAAAATGGAACAGGCAAAAGCGGTGCCTACCTCATCCCCTTACTTGAAAGGCTGGACCTGAAGAAGGACAATATTCAAG CAATGGTGATTGTTCCCAC

TAGAGAACTTGCTCTACAGGTCAGTCAGATTTGCATCCAGGTCAGCAAACACATGGGAGGGGCCAAAGTGATGGCAACCACCGGAGGAACCAATTTACGA

GATGACATAATGAGGCTTGATGATACAG TGCATGTGGTGATCGCTACCCCTGGCAGGATCCTGGATCTCATCAAGAAAGGCGTGGCAAAGGTTGACCAT

GTCCAGATGATAGTGCTAGATGAG GCAGATAAATTGTTGTCACAGGATTTTGTGCAGATAATGGAGGATATTATTCTCACACTACCTAAAAATAGGCAG

ATTTTACTATACTCCGCTACTTTCCCTCTTAGTGTACAAAAGTTTATG AATTCCCATCTGCAAAAACCCTACGAGATAAACCTGATGGAGGAACTAACT

CTGAAAGGAGTAACTCAGTACTACGCATATGTAACGGAGCGCCAAAAAGTGCACTGCCTCAATACACTTTTCTCCAGG CTTCAGATAAACCAGTCCATC

ATTTTCTGCAACTCCTCCCAGAGAGTCGAGCTACTCGCCAAGAAGATTTCTCAGCTGGGCTACTCTTGCTTTTATATCCATGCTAAAATGAGGCAG - U

NI32124 - GAACATCGAAATCGTGTCTTTCATGATTTCCGAAATGGCTTATGCCGCAATCTTGTTTGCACTG ATCTGTTTACCCGAGGTATTGATAT

ACAAGCTGTGAATGTGGTAATAAACTTTGACTTCCCAAAGCTGGCAGAGACCTATCTTCATCGTATTGGAAGATCAG GTCGCTTTGGTCATCTTGGCTT

AGCCATCAACTTGATCACTTATGATGATCGCTTCAACCTGAAGAGTATTGAGGAGCAGCTGGGGACAGAGATCAAACCCATCCCAAGCAACATCGACAAG

AGCCTGTATGTGGCAGAATACCACAGTGAGCCTGCAGAAGACGAGAAACCGTAACAAGCAC GCTTTGACAAACTACAGAAGGCTCTTTGGATCTGTGAC

ACATCATTTTGGGGGGGTGCTCTTCTCTTTGTGGGTTTTTTCATCTTTATTTTGGAACTATGAAGAGTTATATAAGAGCTCAGACATTTTTCTTTTTTTT

AAACTGGTGAAGAAAAACTGAAAAGAAGACATAGACCTTTTTTGTTCCACTTGTTTGCACTGTGTGCTGACTGAACATTCGTTGCACTAACTGCTGGTCT

TTAAAGATGTTTTCTGGGGAAAGGGGACAAGGAAGGAGGAAAAGAAAAGAAGGGGAGAAACCCTAAAAAAGAGAAGAATTTGGGTGAACACATGCACCTG

TCTAAAGTTCTCCACTAGCTGACTCTACTGCATTTCAACTTCTCCCTGATTATTCATCCGTTTTTAAGCCTGAAGAGCTTATTACTTATTTGTGCGAAGT

GCCTTATGCTACAAGACCATTAAGAATATCATCTTTACACACAGCCCAAGGAATCAACAGAGTCATGTTCTATTTTCTTTTTTATTTCTTTGCCTCTTCA

TTTTGGTTTCACGTTGAAGTCTCACCTCCTGTTCTACCAGTACTCAGCCCAGGGCCGGAAGGTGGACTAGTGATGGCAGCGCCATTTTCCTTTTCTTTAT

ATGGAGGAGTTGATTCACAACTGCAGTCCATCCACACTGTACATACATGTATTTAAAAAAAAAAACAATACCAAGTAAAATTTTCTTCCGGGCTGAGTAG

ACGTACCATCGTCGCTCCCAAAGGAAAGAGCAGCCTCTCACTGCAGGAGCCAGATGACAAGCCTCTGTGCTCTACAGCAGAACACTACGCTGGCTCACAC

GCGTCCATGAGCAGGAAGGCACTCGCTGTAAAGACTTGTCGGAGGGAGCCTTGACCTTCTTTCCTCTGTGGCAAAGCGTGACCCGTAGAAAATTGGATGT

GTATACTTGTATAAACTTTGTAAATAAGTTTTTTTTCTGGGTTCATATATATATATATATATATAAATATATATATATACATACATATATATATATTATT

TTTTTTGGATGAAGGTTGCTGGGATTAAGGGATTAGAGTGATTATGGGAGCAGCTAAAGATGAGAGGGGCTCAGTTTTCTGCAACACTAAATTCTAAAAA

GTGCTTTGGCCTCTAACTGTAGGAAGCAGACCTCTGCAGGCTCTGTGTTGGAAAGGGGCCAGAAGCCCGGCCACACTGCTCTTGTAATGAATGCACAGGC

AGCGGTCTTAGCAGACAGCAAAGGAGCTTTGCAAGGCTGTGGTCCCTGGGGGCTTTGAGAAGCTCTGTGGTTTGGCTCTCCTGTCCTAAACGTTTGAGGA

ACTTCCCAAGTTCTGCAAAGGGGAACAAAGATAAATCTTCCTTGGAGTGTGAGAAGTGTACAGAGTGCAGTCTTAGAGGAGAGTGTGTGGAGCATGGATT

TTTATGTCACCGGACCAGCCAGTGCAGCCTCGGCGGGCTTGGCAGTTGTGGAGCCTAGTTATCCGCGGCCCCTCCTGTTGTGTGTGAGCAGCGCCCTCTG

CCTATCTTGATAAATACATTTTTGCAGGAAGGGGCAGCCCGTTAGAGCTGTTAACGTCCATGTCCATGCTGCAGAAAGCTGCTTGCTGCCCGTTCTCTGT

GCCGCACTAAGAGTTGCTGTCTGTCGTTTTGCATTGTAAATCGCTGGCAGATGCCTTAGGTGGTAGTGTTGCTTTAAACTGTGCCCCTCCCAACACGCTT

GATGTTTGGCCTGATCTCCAGGCAAAAGGAGGGAGATGAATCAACCAGTGAACTTTTTTTTTAAAAATGTTTTTAATTCCCTTTTAACCCAGTATACTAG

GTCAGGAGGCATCTAGGG
Translation
 - UNI15377 - MSTARTENPVIMGLSSQNGQLRGPVKASAGPGGGGTQPQPQLNQLKNTSTINNGTPQQAQSMAATIK - UNI11972 - KPGDD

WKKTLKLPPKDLRIKTS - UNI4145 - DVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ - UNI4962 - EESIPIALSGRDILARAKNGTG

KSGAYLIPLLERLDLKKDNIQA AMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTV VHVVIATPGRILDLIKKGVAKVDHVQ

MIVLDE ADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFM NSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSR LQINQSI

IFCNSSQRVELLAKKISQLGYSCFYIHAKMRQ - UNI32124 - EHRNRVFHDFRNGLCRNLVCTD DLFTRGIDIQAVNVVINFDFPKLAETYLHRI

GRSG GRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPAEDEKP 

For any suggestions or comments, please send an email to unitrap@crg.es