Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032105 (Pdzd3)
Chromosomal location
Chr 9: 44055401 - 44059547 (-)
Description
PDZ domain containing 3 Gene [Source:MGI Symbol;Acc:MGI:2429554]
RefSeq_dna
NM_133226 
RefSeq_peptide
NP_573489.2 
UniGene
Mm.29872 
MGI
MGI:2429554 
Uniprot/SWISSPROT
Q99MJ6 
Human Ortholog
not available
Omim not available
UniTrap UNI34322
Vector Insertion
Chr 9: 44058333 - 44058940
Public Clones IST13693F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36199
Vector Insertion
Chr 9: 44056638 - 44057127
Public Clones IST14789A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034618
Sequence
GATCCAACTATGGAGGCAGCTGCAG ATCTTCGGGACACGGCCTTGTTAACTCT - UNI34322 - GAAGTTTAAGTTTAATCCAAGGCTGGGCATTG

ACAATCCTGTCCTCTCCCTCGCTGAAGACCAGGACCAATCTG - UNI34322 - ATCCCTGGAACCTGCACCGGCCTCGCTTTTGTCTGTTGAGCAAG

GAGGAGGAAAAGACTTTTGGGTTCCATTTGCAGCAGCATCTAGGCAAGGCTGACCATGTGGTGTGCAGGGTCGATCCGGGCACCTCAGCCCAGCGCCAGG

GTCTCCGGGAAGGAGATCGGATCCTAGCGGTGAACAATAATATTGTGGCACATGAGGACCACGCGGTG - UNI34322 - GTAGTGCGCTACATCCGG

GCCAGCGGTCCCCGGGTATTGCTGACAGTCTTGGCACAACACGTGCATGATGTGGCGCGTGTTCTGCAGGGGAGTGACGCTTTCCTCTGTCCTACCCTAC

CCTCGGGGGTCAGGCCCCGGTTGTGCCATGTAGTAAAAGATGAAGGCGGCTTTGGCTTCAGCGTCACCCACG GAAGTCGAGGTCCTTTCTGGTTGGTGC

TCAGTGCAGGAGGAGCTGCTGAGAGGGCAGGGGTGCCCCCTGGAGCCAGGCTGCTGGAAGTGAATGGGGCCAGTGTGGAGAAGCTCACATACAACCAGCT

CAATAGGAAG CTTTGGCAGAGTGGAGATCAGGTGACTCTGCTGGTGGCAGGGCTGGAGGTAGAGGAACAGTGTCACCAACTAGGAATGCCTCTTGCTGC

ACCCCTGGCAGAGGGCTGGGCATTGCCCGCCAAGCCCCGATGTCTAAACATAGAGAAAGGACCTGAAGGCTTTGGGTTCCTGCTCCGGGAGGAGAAGGGC

CTGGATGGCCGACTTG - UNI36199 - GGCAGTTCTTGTGGGACGTGGATCCAGGACTACCAGCTGACAAGGCTGGGATGAAGGCTGGAGACCGCCT

GGTGGCTGTGGCCGGGGAAAGCGTGGATGGGCTGGGCCATGAGGAAACAGTGTCTAGAATCCGGGCACAGGGCTCTTGTGTCTCTCTCATTGTCGTCGAT

CCTGAGGCTGACCGCTTCTTCAGCATG - UNI36199 - GTACGCCTGTCTCCCCTCCTCTTCTTGGAGAACACTGAGATTGCTGCTCCTCCTCTGGC

AGAGACCAAGGATCTTCCGGTTGAAGACACAGTTGAGCCTTCTGGCCTTGCTGGCTCCTGCCAATGCTTCTTGTACCCGGGGCCTGGAGGTGGCTATGGA

TTCAGACTCTGCTGTGTGGCCAGTGGGCCTTGTCTTTTCATCTCCCAG - UNI36199 - GTGACCCCAGGAGGCTCAGCTGCCCGGGCAGGGCTGCA

AGTGGGAGATACAGTTTTGGAGGTGAACGGATATCCTGTGGGCGGAGACAGTGAACTGGACAGGCTTCAGCAACTGACTGAGGCTGAGCCACCCCTCTGC

CTGAAGCTAGGAGCTAGGAATCCGCAGGGCTTAGAAGCCTGGATTTCCTTGGAGTCTGGAGAG GACTGGACTCTGGCTTCAGAGTTGCTATAGGACATC

CCTGTTCAGCCTAGCTTACCAGCATAGACTTGCCTAGTAGTTCTCCTGCCCTCGCTCTGCACCCTGAGGTGGAGGGAGCTGGGAACAATCTCTTGAAGTT

GGAATTGGGAGCTGGAGGATTCAGAAACCACCAATCACAGGACTGCCAGGGACCTTCTCCTTTCTCATGAGCCTACCTCCAGCAGAGGGGTGTGGACAGA

GACCGAAGGCGGGCTCCACAGGGAGCCTGAGACGCCACAGGATGCTATATGTGGACATTTTGGGGAGCTGTGCGCCAAAGATGCAGTTCTGCTCAAGAAG

ATGACGCTGTGGAGCCACCGAGGATTGAAGCCATGGAGAACATAGGTTAGATGTGGCTCTGTTGTCATCTGGCAGAAGGATTGATTGGAGGTGTATCTTC

CTTCTACTGTGGATACCTTAGAGTCTTGGGAGCTGGTTCTTGGCTATTGTAATGTCCTGGTACAGCCTTTCCCAGCTGGCTGGTGAGATAGCTTAAAAGG

TAAAGGTGCTGGCTTCTAAGCCTGGCAACCGGAGTTGACTCACCAGAACCACACGGTAGAAGAAGAGAACCAGCTCCTGGAATTTGCCCTCTGACCTCTT

TGTGAGCACTTTAGTATACATACGCTACTGTCCAAATAAATAAGTAAATGTATGTATATGTAT
Translation
MEAAAD DLRDTALLTL - UNI34322 - LKFKFNPRLGIDNPVLSLAEDQDQSD - UNI34322 - DPWNLHRPRFCLLSKEEEKTFGFHLQQHL

GKADHVVCRVDPGTSAQRQGLREGDRILAVNNNIVAHEDHAV - UNI34322 - VVRYIRASGPRVLLTVLAQHVHDVARVLQGSDAFLCPTLPSGVR

PRLCHVVKDEGGFGFSVTHG GSRGPFWLVLSAGGAAERAGVPPGARLLEVNGASVEKLTYNQLNRK LWQSGDQVTLLVAGLEVEEQCHQLGMPLAAPL

AEGWALPAKPRCLNIEKGPEGFGFLLREEKGLDGRLG - UNI36199 - GQFLWDVDPGLPADKAGMKAGDRLVAVAGESVDGLGHEETVSRIRAQGS

CVSLIVVDPEADRFFSM - UNI36199 - VRLSPLLFLENTEIAAPPLAETKDLPVEDTVEPSGLAGSCQCFLYPGPGGGYGFRLCCVASGPCLFISQ

 - UNI36199 - VTPGGSAARAGLQVGDTVLEVNGYPVGGDSELDRLQQLTEAEPPLCLKLGARNPQGLEAWISLESGE DWTLASELL

For any suggestions or comments, please send an email to unitrap@crg.es