Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032118 (Fez1)
Chromosomal location
Chr 9: 36640394 - 36686505 (+)
Description
fasciculation and elongation protein zeta 1 (zygin I) Gene [Source:MGI Symbol;Acc:MGI:2670976]
RefSeq_dna
NM_183171 
RefSeq_peptide
NP_898994.2 
UniGene
Mm.5264 
MGI
MGI:2670976 
Uniprot/SWISSPROT
Q8K0X8 
Uniprot/SPTREMBL
Q3UU92 Q3YE74 
Human Ortholog
ENSG00000149557 (FEZ1)
Omim not available
UniTrap UNI17201
Vector Insertion
Chr 9: 36640497 - 36651246
Public Clones not available
Private Clones OST447632 (lexicon) OST438377 (lexicon) OST438248 (lexicon) OST427688 (lexicon)
OST347029 (lexicon) OST346181 (lexicon) OST344977 (lexicon) OST315324 (lexicon)
OST302190 (lexicon) OST282997 (lexicon) OST280612 (lexicon) OST273811 (lexicon)
OST268865 (lexicon) OST259735 (lexicon) OST240575 (lexicon) OST238292 (lexicon)
OST185840 (lexicon) OST167488 (lexicon) OST149134 (lexicon) OST131541 (lexicon)
OST130746 (lexicon) OST130595 (lexicon) OST112280 (lexicon) OST76174 (lexicon)
OST64435 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27831
Vector Insertion
Chr 9: 36651603 - 36657931
Public Clones not available
Private Clones OST46468 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23434
Vector Insertion
Chr 9: 36658032 - 36668396
Public Clones IST14423E7 (tigm) IST10669G11 (tigm) IST14766C2 (tigm) IST14217G10 (tigm)
Private Clones OST259917 (lexicon) OST258381 (lexicon) OST211382 (lexicon) OST171912 (lexicon)
OST58893 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21604
Vector Insertion
Chr 9: 36683948 - 36686150
Public Clones not available
Private Clones OST324474 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034630
Sequence
GCTTGCCCGCTGACGTTGTGCTGCACCGGGCCACCTCTAGTCGGTGGTTGGGGATGTCTGGCTGAGCCCTGGGATCCGATTCCTTCCTCCAGGACCCGCT

CAG - UNI17201 - GGAAACAGATCTTGACAGTTGCTGTCATTGTACTTCGGTGCCAGGATGGAGGCCCCACTGGTGAGTCTGGATGAAGAGTTTGA

AGATATCAGGCCCAGTTGCACTGAGGAGCCAGAGGAAAAGCCACAGTGTCTGTATGGCACATCTCCTCATCACCTGGAGGACCCTTCCCTCTCTGAGCTT

GAGAATTTTTCTTCCGAAATAATCAGCTTCAAGTCCATGGAGGACCTCGTGAATGAATTTGATGAGAAGCTCAATGTCTGCTTTCGGAACTACAACGCCA

AGACGGAGAGCCTGGCTCCAGTGAAGAACCAGCTGCAGATCCAGGAGGAGGAGGAGACTCTTCGGGATGAGGA - UNI27831 - GGTTTGGGATGCT

CTGACAGACAATTACATCCCTTCACTCTCAGAAGACTGGAGGGACCCAAACATTGAAGCTCTGAATGGCAACAGCTCTGACATTGAG - UNI23434 -

 ATTCATGAGAAGGAAGAAGAAGAGTTCAATGAGAAGAGTGAAAATGACTCTGGCATCAATGAGGAGCCTCTCCTCACAGCTGACCAG GTGATTGAGGA

AATTGAAGAAATGATGCAGAACTCTCCAGATCCTGAAGAGGAAGAGGAGGTGCTAGAAGAGGAGGATGGAGGAGAAATCTCATCCCAGGCAGATTCAGTC

CTGCTACAAGAGATGCAGGCCTTGACACAGACCTTCAACAACAACTGGTCCTATGAAG GGCTGAGACACATGTCTGGGTCTGAGCTGACAGAGCTGCTG

GACCGGGTAGAGGGTGCCATCCGTGACTTCTCAGAGGAGCTGGTCCACCAGCTGGCCCGCAGAGATGAGCTGGAGTTTGAGAAGGAAGTGAAGAACTCCT

TCATCACGGTGCTCATTGAGGTTCAGAACAAGCAGAGGGAGCAGCGGGAACTGATGAAGAAGAGGCGGAAAGAGAAGGGGTTAAGCCTGCAGAGCAACCG

GATAGAGAAGGGAAGTCAGATGCCTCTCAAG CGCTTCAGCATGGAAGGCATCTCCAACATCCTGCAGAGCGGCATCCGCCAGACCTTTGGCTCCTCAGG

AGCTGACAGACAG TATCTGAACACAGTCATCCCTTATGAGAAGAAATCCTCTCCTCCCTCTGTGGAAGACCTGCAGATGCTGACAAACA TTCTCTTCG

CCATGAAGGAGGATAACGAGAAGGTGCCTACTTTGCTAACGGACTACATTTTAAAAG - UNI21604 - TGCTTTGTCCAACCTAACCTCATCTTTGG

AGCAGCCTCACTACAGGAGGTCACTGAGCAAGAAAGTCATTCCATCGCTGGGATTGCATGACACCACGTAACCTCCGGCGTGTATTTAAACGTGTATAGC

TTAACCTGGATTAAACAAGAGCAACTGCGCGCGGGATCCTTTGCTGTTGGCTTCTAGTGCTAGTAATCATTGGATGCATGATCGGGCGCAGGGCCAGAGA

TTCTGCTCCCTCTCCACCTGTGTTGGGGAAGGCAGGTGCCCTCACCACTCATTATGTAGTCTGGCTCCAGCCCTCAACCCAGCTTATACTCTTAAGACTA

ATTTTGAAATAAACCTTCATTTAATT
Translation
 - UNI17201 - MEAPLVSLDEEFEDIRPSCTEEPEEKPQCLYGTSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTESLAP

VKNQLQIQEEEETLRDEE - UNI27831 - EVWDALTDNYIPSLSEDWRDPNIEALNGNSSDIE - UNI23434 - IHEKEEEEFNEKSENDSGIN

EEPLLTADQ VIEEIEEMMQNSPDPEEEEEVLEEEDGGEISSQADSVLLQEMQALTQTFNNNWSYEG GLRHMSGSELTELLDRVEGAIRDFSEELVHQL

ARRDELEFEKEVKNSFITVLIEVQNKQREQRELMKKRRKEKGLSLQSNRIEKGSQMPLK RFSMEGISNILQSGIRQTFGSSGADRQ YLNTVIPYEKKS

SPPSVEDLQMLTNI ILFAMKEDNEKVPTLLTDYILKV - UNI21604 - VLCPT

For any suggestions or comments, please send an email to unitrap@crg.es