Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032119 (Mizf)
Chromosomal location
Chr 9: 44102723 - 44113717 (-)
Description
MBD2-interacting zinc finger Gene [Source:MGI Symbol;Acc:MGI:2429620]
RefSeq_dna
NM_172162 
RefSeq_peptide
NP_751894.1 
UniGene
Mm.24570 
MGI
MGI:2429620 
Uniprot/SWISSPROT
Q8K1K9 
Uniprot/SPTREMBL
Q4FK13 
Human Ortholog
ENSG00000172273 (MIZF)
Omim not available
UniTrap UNI22590
Vector Insertion
Chr 9: 44110671 - 44113698
Public Clones (sanger) IST12054F1 (tigm)
Private Clones OST290858 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24638
Vector Insertion
Chr 9: 44107876 - 44110492
Public Clones not available
Private Clones OST211899 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034629
Sequence
AAACCAGCGGCGCTGGCAG - UNI22590 - GTAAAGGCCATGTCGCCTCCTGGAAAAGTTCCCCGGAAGGAGAACCTGGGGCTCCAGTGTGAGTGGG

GGTCCTGCTCCTTTGTGTGCTCGGCCATGGAGGAGTTCTTCGACCATGTCACTCAGCACCTGCAGCAGCACATGCATGGCTCTAAGGAAGAAGAGGAAGA

GGACCCACTTG - UNI24638 - AGGAAGAATTCTCCTGCTTGTGGCAGGAATGTGGCTTTTGCTCTCTGGACAGTTCTGCCGACCTCATCCGCCATG

TCTACTTCCACTGCTACCACACCAAGCTAAAACAGTGGGGGCTGCAAGCCTTACAAAGCCAGGCTGACCTCAGCCCCTGCATCCTGGACTTTCAGAGCCG

GAACGTCATCCCTGACACCCCTGACCATTTCCTGTGCCTGTGGGAACATTGCGAG AGTGTCTTCGACAATCCTGAGTGGTTCTATCGGCATGTGGATGC

GCACAGCCTGTGCTGTGAATACCAAGCTGTCAGCAAGGACAACCATGTGGTGCAGTGTGGCTGGAAAG GCTGTACCTGTACCTTCAAGGACCGGTGTAA

GCTTCGAGAACACCTCCGCAGCCACACCCAGGAGAAGGTGGTGGCCTGTCCCACCTGTGGGGGCATGTTTGCCAACAACACCAAGTTCTTAGATCACATC

CGTCGCCAGACCTCATTGGATC AGCAGCGATTCCAGTGTTCCCACTGTTCCAAGAGATTTGCCACAGAGAGGCTCTTGCGTGACCACATGCGGAACCAT

G TGAATCACTATAAATGCCCTTTGTGTGACATGACCTGCCCACTGCCTTCTTCCCTCCGGAATCACATGCGCTTTCGACACAGTGAGGACCGACCCTAT

AAATGTGACTGTTGTGACTACAG CTGTAAGAATTTGATTGACCTCCGGAAGCACCTAGACACCCACAGCAAGGAGTCAGCCTACAGGTGTGACTTTGAG

AACTGCAATTTCAGTGCGAGGTCACTCAGCTCTGTCAAGTCCCATCACCGCAAAGTGCATGAA GGAGACTCAGAGCCAAGGTACAAATGTCATGTCTGT

GACAAATGCTTCACACGTGGCAACAACCTCACTGTGCACCTTCGCAAGAAGCACCAGTTCAAGTGGCCCTCAGGACACCCTCGCTTTCG GTACAAGGAA

CATGAAGATGGCTACATGCGACTGCAGCTAGTTCGGTATGAGAGTGTGGAGCTGACACAGCAGTTGCTGCAGCAGTTACAAGAAGGATCAGATCCGGGAT

TGGCACTGAATGAGAGCAGCCTGCAGGGCATTGTTCTGGAAACAGTGCTAGGGGGGCCAGGACCTGAGGAAGAGACAGAAGAGGAAGGTAGGGTTGTTGA

GGGAACAGCTCTCTCAGCTTCTCAGGACAACCCCAGCTCAGCCATTCATATGGTCAGTCAGACAGACACCCAAGGCCAGCGAGACATTGTCTACTGTGTA

CTGTCTGAAGGCCCAGGAGAGCCCCCGCCAGTCTCCGAAACCCTCAAGAGAGATGGAAAAGCTCGAGGAACCTGAGGAGCCGGGGTCCAGGTGGGCTGAG

GCTGCAGAGTCTGGCCGGTCCTGCTCCACATCTTGAAGTTTGAGCTGGGCAGGAAGCGGTGCCCCAGGGGTCAGCCTTTGTTCTTGGATGCCTTTAGAAG

TGGTGCTGAGAACAGTGTGTTCCCCTCTGACTCAGAAGGCATCATTCTATAGACTCTGGGGAGTTGGATTCATTGAGGAAATCCTACATGTATGTTCTTA

TTAGAGGAGCTGTTACCAGGTTTAAGTGTACTCCCTTGGCATGCTAGACAGTAAGTATTTAGTCTACATCCATTCCAATTTCCAGGGATCCATCGATCCA

TTGACCCAGGGATGAGGGACTGTTCTTTCCAAGGGCTGTTTCCTCACTGTTAGTTACGCATTGAGAACCAGGTGCCATTTCTCTCAAGGTTTCCTTTTAC

ATTCCAGGGACACTTGTTATCTTCAGGGACACGATTATAGATACTGTGTATGTGTGGCAGTTGTCTTTTGGGGAATAAAAGAAACACTTGGGCTGTTACT

TATTTCTTAAGTTTGATGGCAGTTAGCCAAGTAACAGATACAGCTGCTTAGAAGTAGAGCTGAATAATTAGACTTCTCCCTTTAGTGCTCAGGACGGTTC

CTTTAACTGTGGTGTACCCATTTAGAGGAGGAGTCCACTTCCTCCAGAGCATCTTCCACTTCTGTGGAAGGAAGCTCCATGGACTTCACCATGAATGAGT

GCTAGCAGTGTTACAAGGTTAATACAAATGGCTCCTGGACAGTACCCTCCGTTCTAATTAGAACCCTGTGCCTCTGTGGTAGGTTGGGGTGTGGGACTGC

AAAGGAAACAGAAATGGAGGTAGGTCAGGAAGTGACCCTAGAGAATGCCAAATACTCAAGGGCCAGGAATCAAGCTAGAAAATCTATACAGTTTCCTACA

GAGTGGATCTATTTTGATAAGCTTATGTCACATATATGATCATGTGTGTGTGTGTGTGTGTTTTGCCTTTATGTATGTAAGTATATCATAGTCAAGCAGT

GTCCATGCAGGTAAAAAGGGTGACCAATCCTCTGGAACTGAAGTTAAAGACAGGTGGGTGCTGGAAACTGAATGTGGTTCTCTGCAAGAGCAACAAGTGC

TCTCGCCTGCTTAGCCATCTCTCCAGCCTCTTTTGTTGTATTCTTGAAGTTGAAATTCCTCAAAAGAATTAACTCTTTTTTTTTCTTTATTTTTAAAGAT

TTTATTTATTTTGTTTATGAGTATACTGTCACTGTTCTCAGACACAAAGAGGACATCAGATTCCCATTGCTGTGGTTGTGAGCCACCATGTGGTTGCTGG

GAATTGAACTGAGGACCTCTGGAAGAACAGTTAGTGCTCTTAACCACTGAGCCATCTCTCCAGCCCCCACCCCACCCTTTTTTTTCCCCAATTGAAAAAC

ATTAGACATAGTGGCACTTACCTTTAATCCTGACACTTAAGGAGACAGAGGCGGGCATTGGAGGTTAAGGCCAGTCTGGTCTACAGAGTGAGTTCTAGAA

TAGCCAGGGCTACATGGAGAAATCCTGTCTC
Translation
 - UNI22590 - MSPPGKVPRKENLGLQCEWGSCSFVCSAMEEFFDHVTQHLQQHMHGSKEEEEEDPLE - UNI24638 - EEEFSCLWQECGFCS

LDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLSPCILDFQSRNVIPDTPDHFLCLWEHCE SVFDNPEWFYRHVDAHSLCCEYQAVSKDNHVVQCGWK

G GCTCTFKDRCKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQ QQRFQCSHCSKRFATERLLRDHMRNHV VNHYKCPLCDMTCPLPS

SLRNHMRFRHSEDRPYKCDCCDYS SCKNLIDLRKHLDTHSKESAYRCDFENCNFSARSLSSVKSHHRKVHE GDSEPRYKCHVCDKCFTRGNNLTVHLR

KKHQFKWPSGHPRFR RYKEHEDGYMRLQLVRYESVELTQQLLQQLQEGSDPGLALNESSLQGIVLETVLGGPGPEEETEEEGRVVEGTALSASQDNPSS

AIHMVSQTDTQGQRDIVYCVLSEGPGEPPPVSETLKRDGKARGT

For any suggestions or comments, please send an email to unitrap@crg.es