Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032135 (Mcam)
Chromosomal location
Chr 9: 43942754 - 43950803 (+)
Description
melanoma cell adhesion molecule Gene [Source:MGI (curated);Acc:Mcam-001]
RefSeq_dna
NM_023061 
RefSeq_peptide
NP_075548.2 
UniGene
Mm.275003 
MGI
MGI:1933966 
Uniprot/SWISSPROT
Q8R2Y2 
Human Ortholog
ENSG00000076706 (MCAM)
Omim not available
UniTrap UNI27046
Vector Insertion
Chr 9: 43942840 - 43944600
Public Clones (sanger)
Private Clones OST76802 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33150
Vector Insertion
Chr 9: 43948777 - 43948927
Public Clones IST10825H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32633
Vector Insertion
Chr 9: 43949476 - 43949866
Public Clones IST12260E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098852
Sequence
CGCCCTCCGTCGGGGAAGCATGGGGCTGCCCAAACTGGTGTGCGTCTTCTTGTTCGCTGCCTGCTGCTGCTGTCGCCGTGCCGCGG - UNI27046 - 

GTGTGCCAGGAGAGGAAAAGCAGCCAGTACCCACGCCCGACCTGGTGGAGGCAGAAGTGGGCAGCACAGCCCTTCTCAAGTGTGGCCCCTCACGGGCCTC

AGGCAACTTCAGCCAAGTGGACTGGTTTTTG ATTCACAAGGAGAGGCAGATACTGATTTTCCGTGTGCACCAAGGCAAGGGCCAGCGGGAACCTGGTGA

ATATGAGCACCGCCTTAGCCTCCAAGACTCGGTGGCTACTCTGGCCCTGAGTCACGTCACTCCCCATGATGAGCGAATGTTCCTGTGTAAGAGCAAGCGA

CCACGGCTCCAGGATCACTACGTTGAGCTTCAGGTCTTCA AAGCCCCAGAGGAACCAACTATTCAAGCCAATGTCGTGGGCATCCATGTGGACAGGCAA

GAGCTCAGGGAG GTTGCTACCTGTGTGGGGAGAAACGGCTACCCCATTCCTCAAGTCCTATGGTACAAGAACAGTCTGCCCTTGCAAGAGGAGGAGAAC

C GAGTTCATATCCAGTCATCACAGATTGTCGAGTCCAGTGGCTTGTACACCTTGAAGAGTGTTCTGAGTGCACGCCTAGTTAAGGAAGACAAAGATGCC

CAGTTTTACTGTGAACTCAGCTACCGGCTACCCAGTGGGAACCACATGAAGGAATCTAAGGAGGTCACTGTCCCTGTTTTCT ACCCTGCAGAAAAAGTG

TGGGTGGAGGTAGAGCCTGTGGGGCTGCTGAAGGAAGGGGATCATGTGACAATCAGGTGTCTGACAGATGGCAACCCTCAACCCCACTTCACTATCAACA

AGAAG GACCCCAGCACTGGGGAGATGGAAGAGGAGAGCACCGATGAAAATGGGCTCCTGTCCTTGGAGCCTGCCGAAAAGCACCATAGCGGGCTCTACC

AGTGTCAGAGTCTGGACCTGGAAACTACCATCACACTGTCAAGTGACCCCCTGGAGCTGCTGGTGAACT ATGTGTCTGATGTTCAAGTGAATCCAACTG

CCCCTGAAGTCCAGGAAGGTGAGAGCCTCACGCTGACCTGCGAGGCAGAAAGTAACCAGGACCTTGAGTTTGAGTGGCTGAGAGACAAG ACAGGCCAGC

TGCTGGGAAAGGGTCCCGTCCTCCAGCTAAACAACGTGAGACGGGAAGCAGGGGGACGGTATCTCTGCATGGCATCTGTCCCCAGAGTTCCTGGCTTGAA

TCGTACCCAGCTGGTCAGCGTGGGCATTTTTG GGTCCCCATGGATGGCATTAAAGGAGAGGAAGGTGTGGGTGCAAGAGAATGCAGTGCTGAATCTGTC

TTGTGAGGCTTCAGGACATCCTCAGCCCACCATCTCCTGGAATGTCAATGGTTCG GCAACTGAATGGAACCCAGATCCACAGACAGTAGTGAGCACCTT

GAATGTCCTTGTGACGCCAGAGCTTCTGGAGACAGGTGCAGAGTGTACAGCCTCCAACTCCCTGGGCTCAAACACCACCACCATTGTTCTGAAGCTGG T

CACTTTAACCACCCTCATACCTGACTCCAGCCAAACCACTGGCCTCAGCACCCTCACAGTCAGTCCTCACACCAGAGCCAACAGCACCTCCACAG - UN

I33150 - AGAAAAAGCTGCCACAGCCAGAGAGCAAAGGTGTGGTCATCGTGGCTGTGATAGTGTGTACCTTGGTGCTTGCTGTGCTGGGTGCTGCTCT

CTATTTCTTCTACAAGAAGGGCAAGCTGCCATGTGGACGCTCGGGAAAACAGGAGAT - UNI32633 - GGAGAGAAATACATCGATCTGAGGCATTA

GATGGCTCCCATTGCACTGCTCGCAGCTCCCTGCTCAGACTTCACCCCAAGCTGAAGCCTCCAGAGGGACAGCAGGGACGAGCCACACTCAACCCCCCCC

CTGCACATCAGGTCTGAGAGCTAGGAGCTGGGACAGGAGTCGTCTGCAGGAGCTCAGTTGGCTACAGAGGCCTGGTTTTAGAGACCAAGCCCTCCTCTGT

GTCCAGTAAATAATGCTTATCCCAAGGGGCCCGTCTCCCAGGGCATTTCCCCCTCCCGTGCACAGCCATTGGTGGCAAATCCTTCTGCCATCAGCTGTGT

GGGCTTGCCTCTTTGAGCTCATCTCCCCTCACAGGCTGTCTTCATGATGCAGGACCTGGGCACATGGTCACATTATTCCGTTCACATTGGTCCTTGTGAG

AACCTCACAGTCTGGAGGCGGCTGCTTTTGTACCTTCCTGCCTGCTACTAATTCAGGGTCTCATTTGGAACATTTTTCCTTTGGGTAGTGGTCAGGAACT

GGTGTAAGTCCTCCAGACACATCCCTGTGTAAGGAAGCCAGGCACTGTTTCTCTGAGTTTTGTTGTTTTGTTTTCTTTGAAGGCTACTGAGCCCAAGCTT

CCCGCATTCCCTTAGTAACAAGAGACAGGACAGAGAGAAGGTCTACTGTTCATGGGGATTAGGCTTATAGGAATGTTAGTACCAAATTTCTACATGTGAG

CTTTGGGGGCCAGGTCCTAGAGAGCCCAAGTGGGAGAATGGTATTTAGGAGATGAAAAACCTGGCCTAGCAAGAGCTTTTGAGGTGTGTGTGTGTGTGTG

TGTATACATATATGTGTGTATATATATATATATATATATGGTTTTGTCTGTAAATTTGCAAATTTTTCCTTTTATATGTGTGTTAGAAAAATAAAGTGTT

ATTGTTCC
Translation
MGLPKLVCVFLFAACCCCRRAAG - UNI27046 - GVPGEEKQPVPTPDLVEAEVGSTALLKCGPSRASGNFSQVDWFL IHKERQILIFRVHQGKGQ

REPGEYEHRLSLQDSVATLALSHVTPHDERMFLCKSKRPRLQDHYVELQVFK KAPEEPTIQANVVGIHVDRQELRE VATCVGRNGYPIPQVLWYKNSL

PLQEEENR RVHIQSSQIVESSGLYTLKSVLSARLVKEDKDAQFYCELSYRLPSGNHMKESKEVTVPVFY YPAEKVWVEVEPVGLLKEGDHVTIRCLTD

GNPQPHFTINKK DPSTGEMEEESTDENGLLSLEPAEKHHSGLYQCQSLDLETTITLSSDPLELLVNY YVSDVQVNPTAPEVQEGESLTLTCEAESNQD

LEFEWLRDK TGQLLGKGPVLQLNNVRREAGGRYLCMASVPRVPGLNRTQLVSVGIFG GSPWMALKERKVWVQENAVLNLSCEASGHPQPTISWNVNGS

 ATEWNPDPQTVVSTLNVLVTPELLETGAECTASNSLGSNTTTIVLKLV VTLTTLIPDSSQTTGLSTLTVSPHTRANSTSTE - UNI33150 - EKK

LPQPESKGVVIVAVIVCTLVLAVLGAALYFFYKKGKLPCGRSGKQEM - UNI32633 - MERNTSI
Transcript ENSMUST00000034650
Sequence
CGCCCTCCGTCGGGGAAGCATGGGGCTGCCCAAACTGGTGTGCGTCTTCTTGTTCGCTGCCTGCTGCTGCTGTCGCCGTGCCGCGG - UNI27046 - 

GTGTGCCAGGAGAGGAAAAGCAGCCAGTACCCACGCCCGACCTGGTGGAGGCAGAAGTGGGCAGCACAGCCCTTCTCAAGTGTGGCCCCTCACGGGCCTC

AGGCAACTTCAGCCAAGTGGACTGGTTTTTG ATTCACAAGGAGAGGCAGATACTGATTTTCCGTGTGCACCAAGGCAAGGGCCAGCGGGAACCTGGTGA

ATATGAGCACCGCCTTAGCCTCCAAGACTCGGTGGCTACTCTGGCCCTGAGTCACGTCACTCCCCATGATGAGCGAATGTTCCTGTGTAAGAGCAAGCGA

CCACGGCTCCAGGATCACTACGTTGAGCTTCAGGTCTTCA AAGCCCCAGAGGAACCAACTATTCAAGCCAATGTCGTGGGCATCCATGTGGACAGGCAA

GAGCTCAGGGAG GTTGCTACCTGTGTGGGGAGAAACGGCTACCCCATTCCTCAAGTCCTATGGTACAAGAACAGTCTGCCCTTGCAAGAGGAGGAGAAC

C GAGTTCATATCCAGTCATCACAGATTGTCGAGTCCAGTGGCTTGTACACCTTGAAGAGTGTTCTGAGTGCACGCCTAGTTAAGGAAGACAAAGATGCC

CAGTTTTACTGTGAACTCAGCTACCGGCTACCCAGTGGGAACCACATGAAGGAATCTAAGGAGGTCACTGTCCCTGTTTTCT ACCCTGCAGAAAAAGTG

TGGGTGGAGGTAGAGCCTGTGGGGCTGCTGAAGGAAGGGGATCATGTGACAATCAGGTGTCTGACAGATGGCAACCCTCAACCCCACTTCACTATCAACA

AGAAG GACCCCAGCACTGGGGAGATGGAAGAGGAGAGCACCGATGAAAATGGGCTCCTGTCCTTGGAGCCTGCCGAAAAGCACCATAGCGGGCTCTACC

AGTGTCAGAGTCTGGACCTGGAAACTACCATCACACTGTCAAGTGACCCCCTGGAGCTGCTGGTGAACT ATGTGTCTGATGTTCAAGTGAATCCAACTG

CCCCTGAAGTCCAGGAAGGTGAGAGCCTCACGCTGACCTGCGAGGCAGAAAGTAACCAGGACCTTGAGTTTGAGTGGCTGAGAGACAAG ACAGGCCAGC

TGCTGGGAAAGGGTCCCGTCCTCCAGCTAAACAACGTGAGACGGGAAGCAGGGGGACGGTATCTCTGCATGGCATCTGTCCCCAGAGTTCCTGGCTTGAA

TCGTACCCAGCTGGTCAGCGTGGGCATTTTTG GGTCCCCATGGATGGCATTAAAGGAGAGGAAGGTGTGGGTGCAAGAGAATGCAGTGCTGAATCTGTC

TTGTGAGGCTTCAGGACATCCTCAGCCCACCATCTCCTGGAATGTCAATGGTTCG GCAACTGAATGGAACCCAGATCCACAGACAGTAGTGAGCACCTT

GAATGTCCTTGTGACGCCAGAGCTTCTGGAGACAGGTGCAGAGTGTACAGCCTCCAACTCCCTGGGCTCAAACACCACCACCATTGTTCTGAAGCTGG T

CACTTTAACCACCCTCATACCTGACTCCAGCCAAACCACTGGCCTCAGCACCCTCACAGTCAGTCCTCACACCAGAGCCAACAGCACCTCCACAG - UN

I33150 - AGAAAAAGCTGCCACAGCCAGAGAGCAAAGGTGTGGTCATCGTGGCTGTGATAGTGTGTACCTTGGTGCTTGCTGTGCTGGGTGCTGCTCT

CTATTTCTTCTACAAGAAGGGCAAGCTGCCATGTGGACGCTCGGGAAAACAGGAGAT CACGCTGCCCCCGACTCGTAAGAGTGAATTTGTAGTTGAAGT

TAAGTCAGATAAGCTCCCAGAAGAGATGGCTCTCCTTCAGGGCAGCAACGGTGACAAGAGGGCTCCAGGAGACCAG - UNI32633 - GGAGAGAAAT

ACATCGATCTGAGGCATTAGATGGCTCCCATTGCACTGCTCGCAGCTCCCTGCTCAGACTTCACCCCAAGCTGAAGCCTCCAGAGGGACAGCAGGGACGA

GCCACACTCAACCCCCCCCCTGCACATCAGGTCTGAGAGCTAGGAGCTGGGACAGGAGTCGTCTGCAGGAGCTCAGTTGGCTACAGAGGCCTGGTTTTAG

AGACCAAGCCCTCCTCTGTGTCCAGTAAATAATGCTTATCCCAAGGGGCCCGTCTCCCAGGGCATTTCCCCCTCCCGTGCACAGCCATTGGTGGCAAATC

CTTCTGCCATCAGCTGTGTGGGCTTGCCTCTTTGAGCTCATCTCCCCTCACAGGCTGTCTTCATGATGCAGGACCTGGGCACATGGTCACATTATTCCGT

TCACATTGGTCCTTGTGAGAACCTCACAGTCTGGAGGCGGCTGCTTTTGTACCTTCCTGCCTGCTACTAATTCAGGGTCTCATTTGGAACATTTTTCCTT

TGGGTAGTGGTCAGGAACTGGTGTAAGTCCTCCAGACACATCCCTGTGTAAGGAAGCCAGGCACTGTTTCTCTGAGTTTTGTTGTTTTGTTTTCTTTGAA

GGCTACTGAGCCCAAGCTTCCCGCATTCCCTTAGTAACAAGAGACAGGACAGAGAGAAGGTCTACTGTTCATGGGGATTAGGCTTATAGGAATGTTAGTA

CCAAATTTCTACATGTGAGCTTTGGGGGCCAGGTCCTAGAGAGCCCAAGTGGGAGAATGGTATTTAGGAGATGAAAAACCTGGCCTAGCAAGAGCTTTTG

AGGTGTGTGTGTGTGTGTGTGTATACATATATGTGTGTATATATATATATATATATATGGTTTTGTCTGTAAATTTGCAAATTTTTCCTTTTATATGTGT

GTTAGAAAAATAAAGTGTTATTGTTCC
Translation
MGLPKLVCVFLFAACCCCRRAAG - UNI27046 - GVPGEEKQPVPTPDLVEAEVGSTALLKCGPSRASGNFSQVDWFL IHKERQILIFRVHQGKGQ

REPGEYEHRLSLQDSVATLALSHVTPHDERMFLCKSKRPRLQDHYVELQVFK KAPEEPTIQANVVGIHVDRQELRE VATCVGRNGYPIPQVLWYKNSL

PLQEEENR RVHIQSSQIVESSGLYTLKSVLSARLVKEDKDAQFYCELSYRLPSGNHMKESKEVTVPVFY YPAEKVWVEVEPVGLLKEGDHVTIRCLTD

GNPQPHFTINKK DPSTGEMEEESTDENGLLSLEPAEKHHSGLYQCQSLDLETTITLSSDPLELLVNY YVSDVQVNPTAPEVQEGESLTLTCEAESNQD

LEFEWLRDK TGQLLGKGPVLQLNNVRREAGGRYLCMASVPRVPGLNRTQLVSVGIFG GSPWMALKERKVWVQENAVLNLSCEASGHPQPTISWNVNGS

 ATEWNPDPQTVVSTLNVLVTPELLETGAECTASNSLGSNTTTIVLKLV VTLTTLIPDSSQTTGLSTLTVSPHTRANSTSTE - UNI33150 - EKK

LPQPESKGVVIVAVIVCTLVLAVLGAALYFFYKKGKLPCGRSGKQEI ITLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQ - UNI32633 

- GEKYIDLRH

For any suggestions or comments, please send an email to unitrap@crg.es