Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032177 (Pde4a)
Chromosomal location
Chr 9: 20970158 - 21016043 (+)
Description
phosphodiesterase 4A, cAMP specific Gene [Source:MGI Symbol;Acc:MGI:99558]
RefSeq_dna
NM_019798 NM_183408 
RefSeq_peptide
NP_062772.3 NP_899668.1 
UniGene
Mm.191749 
MGI
MGI:99558 
Uniprot/SWISSPROT
O89084 
Uniprot/SPTREMBL
Q3TUD0 Q80UU8 B2RTL2 O70285 
Human Ortholog
ENSG00000065989 (PDE4A)
Omim not available
UniTrap UNI33768
Vector Insertion
Chr 9: 20970677 - 20986067
Public Clones IST14040D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16742
Vector Insertion
Chr 9: 20988996 - 20995770
Public Clones IST13326B6 (tigm)
Private Clones OST455216 (lexicon) OST444591 (lexicon) OST279880 (lexicon) OST260188 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24667
Vector Insertion
Chr 9: 20996876 - 20996963
Public Clones not available
Private Clones OST210755 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20710
Vector Insertion
Chr 9: 21010772 - 21015137
Public Clones CMHD-GT_450B5-3 (cmhd) CMHD-GT_445E9-3 (cmhd)
Private Clones OST354034 (lexicon) OST353122 (lexicon) OST323304 (lexicon) OST314058 (lexicon)
OST287792 (lexicon) OST219869 (lexicon) OST102484 (lexicon) OST15530 (lexicon)
OST13896 (lexicon) OST7120 (lexicon) OST5749 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003395
Sequence
ATGCCTCTGGTTGACTTCTTCTGCGAGACCTGCTCCAAGCCCTGGCTGGTGGGCTGGTGGGACCAG TTTAAAAGGATGCTGAACCGGGAACTCACACAC

CTGTCGGAAATGAGCAGGTCAGGAAACCAGGTCTCAGAGTACATTTCCAACACGTTCCTAG ACAAGCAGCACGAAGTGGAGATCCCATCGCCCACGCCG

CGACAGAGACCCTTCCAGCAGCCCCCACCAGCAGCAGTGCAGCAGGCCCAGCCCATGTCTCAGATCACAGGGCTGAAAAAGCTGGTACACACCGGAAGCT

TGAACATCAATGTCCCACGATTTGGAGTCAAGACAGATCAGGAGGACCTCTTAGCACAA GAACTGGAGAACTTGAGCAAATGGGGCCTGAACATCTTTT

GTGTGTCGGAGTACGCTGGAGGCCGTTCACTCAGCTGTATCATGTATACGATATTCCAG GAGCGGGACTTACTGAAGAAATTCCACATCCCCGTGGACA

CCATGATGACATACATGCTGACGCTGGAGGACCACTACCACGCTGACGTGGCCTACCACAACAGCCTGCACGCAGCCGATGTGCTACAGTCCACACATGT

GCTGCTGGCCACGCCTGCACTGGAT GCCGTGTTCACAGACCTGGAGATTCTTGCTGCTCTCTTCGCTGCTGCCATCCATGACGTGGACCACCCTGGCGT

CTCCAACCAGTTCCTAATCAACACCA ATTCGGAGCTGGCATTGATGTACAACGATGAGTCTGTGCTTGAGAACCACCACCTGGCTGTGGGATTCAAGCT

GCTGCAAGAAGAGAACTGCGACATCTTCCAGAACCTCAGCAAGCGCCAGCGGCAGAGCCTGCGCAAGATGGTCATCGACATG GTGCTGGCCACAGACAT

GTCCAAGCACATGACCCTTCTGGCTGACCTGAAGACTATGGTAGAGACGAAGAAAGTGACCAGCTCTGGAGTTCTCTTGCTGGACAACTACTCTGACCGT

ATCCAG GTCCTCAGGAACATGGTGCACTGTGCAGACCTCAGCAATCCCACCAAGCCCCTGGAGCTGTACCGACAATGGACTGATCGCATCATGGCTGAG

TTCTTCCAGCAGGGTGACCGAGAACGGGAACGCGGAATGGAGATTAGCCCCATGTGTGACAAGCACACAGCCTCTGTGGAGAAGTCTCAG - UNI2071

0 - GTGGGCTTCATCGACTATATTGTTCACCCACTGTGGGAGACGTGGGCCGATCTCGTCCACCCCGATGCCCAAGACATCCTGGACACGCTGGAAGAC

AACCGGGATTGGTATCACAGTGCCATCCGCCAGAGTCCCTCCCCAACCCTGGAAGAGGAGCCAGGAGTGCTCAGCGATCCGGCCCTGCCTGACAAGTTCC

AATTTGAGCTCACCTTGGAGGAAGAGGATGAAGAGGATTCATTGGAGGTTCCAGGATTGCCTTGCACTGAGGAAACTCTCCTGGCTCCACATGATACCAG

AGCTCAAGCCATGGAACAGTCAAAGGTCAAAGGCCAGAGCCCTGCTGTTGTGGAGGTAGCAGAGAGTTTGAAGCAGGAGACAGCCTCAGCACATGGCGCT

CCTGAGGAGTCCGCGGAGGCTGTGGGCCATTCCTTCAGCCTTGAAACCTCTATTCTGCCTGACTTGAGGACCCTGTCCCCCTCAGAGGAGGCCCAGGGCC

TCCTGGGCCTCCCCTCCATGGCGGCAGAGGTGGAGGCCCCAAGAGACCATCTGGCTGCCATGAGGGCTTGTTCTGCCTGCTCGGGGACATCAGGAGACAA

TTCTGCCGTCATCTCTGCTCCAGGCAGGTGGGGGTCAGGTGGAGACCCTGCCTGATCCCTTTTCCCTTCACCCTCGGCTCCTCCCTCCTCCCCACACTCT

CCACTCACCACAGACCACCTCAACGACTCCTGGCCCTCCTGAGAAAAAAGAAAACAGAAAAGTGGGGTTTTTTCTCTTTTCTTTTTTTCACCCTTCCCCC

CCTGCCCTTGCCCACAGGGCCTTTTTGTTGAAGTGGGGTATGGAGAGCCAGGAACTGAAGTCCCCCAAAAAAGGGATTTTATTTTTTTGAATTTTAATTG

TAACGTTTTT
Translation
MPLVDFFCETCSKPWLVGWWDQ FKRMLNRELTHLSEMSRSGNQVSEYISNTFLD DKQHEVEIPSPTPRQRPFQQPPPAAVQQAQPMSQITGLKKLVHT

GSLNINVPRFGVKTDQEDLLAQ ELENLSKWGLNIFCVSEYAGGRSLSCIMYTIFQ ERDLLKKFHIPVDTMMTYMLTLEDHYHADVAYHNSLHAADVLQ

STHVLLATPALD AVFTDLEILAALFAAAIHDVDHPGVSNQFLINTN NSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKRQRQSLRKMVIDM

 VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQ VLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASV

EKSQ - UNI20710 - VGFIDYIVHPLWETWADLVHPDAQDILDTLEDNRDWYHSAIRQSPSPTLEEEPGVLSDPALPDKFQFELTLEEEDEEDSLEV

PGLPCTEETLLAPHDTRAQAMEQSKVKGQSPAVVEVAESLKQETASAHGAPEESAEAVGHSFSLETSILPDLRTLSPSEEAQGLLGLPSMAAEVEAPRDH

LAAMRACSACSGTSGDNSAVISAPGRWGSGGDPA
Transcript ENSMUST00000115458
Sequence
ACCTTGGGCCTGGCGTGCAGTGCCGCACACCCTCCCGTGCAGCAGCTGGTCCCCAATGCCGGCCCCGACGGCTTGGCTCTCATGCGCTCCAGTGCAGCAC

CCCGGGCCCGGCCCCGACCCCCAGCCTTGGCATTGCCCCTAGGACCGGAGTCATTGACCCATTTCTCCTTCAGCGAGGAGGACACTCTTCGACACCCTCC

GGGCAGATGTGTCAG - UNI16742 - CTTGGAGGCAGAAAATGGGCCAACACCGTCCCCTGGCCGCAGCCCCCTGGACTCGCAGGCGAGCCCGGGGC

TTATGCTGCATGCCGGGGCAGCCACCAGCCAGCGCCGAGAATCCTTCCTCTATCGCTCAGACAGCGACTATGACATGTCACCGAAGACTATGTCCAGGAA

CTCATCCGTCGCCAGCGAAGC GCATGGTGAAGACCTCATTGTGACCCCGTTTGCCCAG - UNI24667 - GTGCTGGCCAGTCTCCGCAACGTTCGA

AGCAACTTCTCACTCCTAACCAATGTGCCCATCCCCAGCAACAA GAGGTCCCCGCTGGGCGGGCCACCCTCTGTCTGCAAGGCCACACTGTCAG AGGA

GACATGCCAGCAGCTGGCCCGGGAGACCCTGGAAGAGCTGGATTGGTGCCTGGAGCAGCTGGAGACCATGCAGACCTACCGCTCTGTCAGCGAGATGGCC

TCACACAAG TTTAAAAGGATGCTGAACCGGGAACTCACACACCTGTCGGAAATGAGCAGGTCAGGAAACCAGGTCTCAGAGTACATTTCCAACACGTTC

CTAG ACAAGCAGCACGAAGTGGAGATCCCATCGCCCACGCCGCGACAGAGACCCTTCCAGCAGCCCCCACCAGCAGCAGTGCAGCAGGCCCAGCCCATG

TCTCAGATCACAGGGCTGAAAAAGCTGGTACACACCGGAAGCTTGAACATCAATGTCCCACGATTTGGAGTCAAGACAGATCAGGAGGACCTCTTAGCAC

AA GAACTGGAGAACTTGAGCAAATGGGGCCTGAACATCTTTTGTGTGTCGGAGTACGCTGGAGGCCGTTCACTCAGCTGTATCATGTATACGATATTCC

AG GAGCGGGACTTACTGAAGAAATTCCACATCCCCGTGGACACCATGATGACATACATGCTGACGCTGGAGGACCACTACCACGCTGACGTGGCCTACC

ACAACAGCCTGCACGCAGCCGATGTGCTACAGTCCACACATGTGCTGCTGGCCACGCCTGCACTGGAT GCCGTGTTCACAGACCTGGAGATTCTTGCTG

CTCTCTTCGCTGCTGCCATCCATGACGTGGACCACCCTGGCGTCTCCAACCAGTTCCTAATCAACACCA ATTCGGAGCTGGCATTGATGTACAACGATG

AGTCTGTGCTTGAGAACCACCACCTGGCTGTGGGATTCAAGCTGCTGCAAGAAGAGAACTGCGACATCTTCCAGAACCTCAGCAAGCGCCAGCGGCAGAG

CCTGCGCAAGATGGTCATCGACATG GTGCTGGCCACAGACATGTCCAAGCACATGACCCTTCTGGCTGACCTGAAGACTATGGTAGAGACGAAGAAAGT

GACCAGCTCTGGAGTTCTCTTGCTGGACAACTACTCTGACCGTATCCAG GTCCTCAGGAACATGGTGCACTGTGCAGACCTCAGCAATCCCACCAAGCC

CCTGGAGCTGTACCGACAATGGACTGATCGCATCATGGCTGAGTTCTTCCAGCAGGGTGACCGAGAACGGGAACGCGGAATGGAGATTAGCCCCATGTGT

GACAAGCACACAGCCTCTGTGGAGAAGTCTCAG - UNI20710 - GTGGGCTTCATCGACTATATTGTTCACCCACTGTGGGAGACGTGGGCCGATCT

CGTCCACCCCGATGCCCAAGACATCCTGGACACGCTGGAAGACAACCGGGATTGGTATCACAGTGCCATCCGCCAGAGTCCCTCCCCAACCCTGGAAGAG

GAGCCAGGAGTGCTCAGCGATCCGGCCCTGCCTGACAAGTTCCAATTTGAGCTCACCTTGGAGGAAGAGGATGAAGAGGATTCATTGGAGGTTCCAGGAT

TGCCTTGCACTGAGGAAACTCTCCTGGCTCCACATGATACCAGAGCTCAAGCCATGGAACAGTCAAAGGTCAAAGGCCAGAGCCCTGCTGTTGTGGAGGT

AGCAGAGAGTTTGAAGCAGGAGACAGCCTCAGCACATGGCGCTCCTGAGGAGTCCGCGGAGGCTGTGGGCCATTCCTTCAGCCTTGAAACCTCTATTCTG

CCTGACTTGAGGACCCTGTCCCCCTCAGAGGAGGCCCAGGGCCTCCTGGGCCTCCCCTCCATGGCGGCAGAGGTGGAGGCCCCAAGAGACCATCTGGCTG

CCATGAGGGCTTGTTCTGCCTGCTCGGGGACATCAGGAGACAATTCTGCCGTCATCTCTGCTCCAGGCAGGTGGGGGTCAGGTGGAGACCCTGCCTGATC

CCTTTTCCCTTCACCCTCGGCTCCTCCCTCCTCCCCACACTCTCCACTCACCACAGACCACCTCAACGACTCCTGGCCCTCCTGAGAAAAAAGAAAACAG

AAAAGTGGGGTTTTTTCTCTTTTCTTTTTTTCACCCTTCCCCCCCTGCCCTTGCCCACAGGGCCTTTTTGTTGAAGTGGGGTATGGAGAGCCAGGAACTG

AAGTCCCCCAAAAAAGGGATTTTATTTTTTTGAATTTTAATTGTAACGTTTTT
Translation
MRSSAAPRARPRPPALALPLGPESLTHFSFSEEDTLRHPPGRCVS - UNI16742 - SLEAENGPTPSPGRSPLDSQASPGLMLHAGAATSQRRESFL

YRSDSDYDMSPKTMSRNSSVASEA AHGEDLIVTPFAQ - UNI24667 - VLASLRNVRSNFSLLTNVPIPSNK KRSPLGGPPSVCKATLSE EETC

QQLARETLEELDWCLEQLETMQTYRSVSEMASHK FKRMLNRELTHLSEMSRSGNQVSEYISNTFLD DKQHEVEIPSPTPRQRPFQQPPPAAVQQAQPM

SQITGLKKLVHTGSLNINVPRFGVKTDQEDLLAQ ELENLSKWGLNIFCVSEYAGGRSLSCIMYTIFQ ERDLLKKFHIPVDTMMTYMLTLEDHYHADVA

YHNSLHAADVLQSTHVLLATPALD AVFTDLEILAALFAAAIHDVDHPGVSNQFLINTN NSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKR

QRQSLRKMVIDM VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQ VLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGME

ISPMCDKHTASVEKSQ - UNI20710 - VGFIDYIVHPLWETWADLVHPDAQDILDTLEDNRDWYHSAIRQSPSPTLEEEPGVLSDPALPDKFQFELT

LEEEDEEDSLEVPGLPCTEETLLAPHDTRAQAMEQSKVKGQSPAVVEVAESLKQETASAHGAPEESAEAVGHSFSLETSILPDLRTLSPSEEAQGLLGLP

SMAAEVEAPRDHLAAMRACSACSGTSGDNSAVISAPGRWGSGGDPA
Transcript ENSMUST00000069577
Sequence
ATGGCGCGGAGGGGCTGGGGTCGTATCCCCGAGCCGTGCGCGGCGGCCTTCCCGGAGGCGGTGGCCGAGGACGACGCGTTCCTACCCGGGCCCCCCACGG

TGTCCGCGTTCCTCAGCAGCACAACGCCAATGCCCTACAGACGCCTGCGGCTCTTCCGAGGCAGTGTACAGGACTGGGGCCGCCAGGCTTGGGCCGG - 

UNI16742 - CTTGGAGGCAGAAAATGGGCCAACACCGTCCCCTGGCCGCAGCCCCCTGGACTCGCAGGCGAGCCCGGGGCTTATGCTGCATGCCGGGG

CAGCCACCAGCCAGCGCCGAGAATCCTTCCTCTATCGCTCAGACAGCGACTATGACATGTCACCGAAGACTATGTCCAGGAACTCATCCGTCGCCAGCGA

AGC GCATGGTGAAGACCTCATTGTGACCCCGTTTGCCCAG - UNI24667 - GTGCTGGCCAGTCTCCGCAACGTTCGAAGCAACTTCTCACTCCTA

ACCAATGTGCCCATCCCCAGCAACAA GAGGTCCCCGCTGGGCGGGCCACCCTCTGTCTGCAAGGCCACACTGTCAG AGGAGACATGCCAGCAGCTGGC

CCGGGAGACCCTGGAAGAGCTGGATTGGTGCCTGGAGCAGCTGGAGACCATGCAGACCTACCGCTCTGTCAGCGAGATGGCCTCACACAAG TTTAAAAG

GATGCTGAACCGGGAACTCACACACCTGTCGGAAATGAGCAGGTCAGGAAACCAGGTCTCAGAGTACATTTCCAACACGTTCCTAG ACAAGCAGCACGA

AGTGGAGATCCCATCGCCCACGCCGCGACAGAGACCCTTCCAGCAGCCCCCACCAGCAGCAGTGCAGCAGGCCCAGCCCATGTCTCAGATCACAGGGCTG

AAAAAGCTGGTACACACCGGAAGCTTGAACATCAATGTCCCACGATTTGGAGTCAAGACAGATCAGGAGGACCTCTTAGCACAA GAACTGGAGAACTTG

AGCAAATGGGGCCTGAACATCTTTTGTGTGTCGGAGTACGCTGGAGGCCGTTCACTCAGCTGTATCATGTATACGATATTCCAG GAGCGGGACTTACTG

AAGAAATTCCACATCCCCGTGGACACCATGATGACATACATGCTGACGCTGGAGGACCACTACCACGCTGACGTGGCCTACCACAACAGCCTGCACGCAG

CCGATGTGCTACAGTCCACACATGTGCTGCTGGCCACGCCTGCACTGGAT GCCGTGTTCACAGACCTGGAGATTCTTGCTGCTCTCTTCGCTGCTGCCA

TCCATGACGTGGACCACCCTGGCGTCTCCAACCAGTTCCTAATCAACACCA ATTCGGAGCTGGCATTGATGTACAACGATGAGTCTGTGCTTGAGAACC

ACCACCTGGCTGTGGGATTCAAGCTGCTGCAAGAAGAGAACTGCGACATCTTCCAGAACCTCAGCAAGCGCCAGCGGCAGAGCCTGCGCAAGATGGTCAT

CGACATG GTGCTGGCCACAGACATGTCCAAGCACATGACCCTTCTGGCTGACCTGAAGACTATGGTAGAGACGAAGAAAGTGACCAGCTCTGGAGTTCT

CTTGCTGGACAACTACTCTGACCGTATCCAG GTCCTCAGGAACATGGTGCACTGTGCAGACCTCAGCAATCCCACCAAGCCCCTGGAGCTGTACCGACA

ATGGACTGATCGCATCATGGCTGAGTTCTTCCAGCAGGGTGACCGAGAACGGGAACGCGGAATGGAGATTAGCCCCATGTGTGACAAGCACACAGCCTCT

GTGGAGAAGTCTCAG - UNI20710 - GTGGGCTTCATCGACTATATTGTTCACCCACTGTGGGAGACGTGGGCCGATCTCGTCCACCCCGATGCCCA

AGACATCCTGGACACGCTGGAAGACAACCGGGATTGGTATCACAGTGCCATCCGCCAGAGTCCCTCCCCAACCCTGGAAGAGGAGCCAGGAGTGCTCAGC

GATCCGGCCCTGCCTGACAAGTTCCAATTTGAGCTCACCTTGGAGGAAGAGGATGAAGAGGATTCATTGGAGGTTCCAGGATTGCCTTGCACTGAGGAAA

CTCTCCTGGCTCCACATGATACCAGAGCTCAAGCCATGGAACAGTCAAAGGTCAAAGGCCAGAGCCCTGCTGTTGTGGAGGTAGCAGAGAGTTTGAAGCA

GGAGACAGCCTCAGCACATGGCGCTCCTGAGGAGTCCGCGGAGGCTGTGGGCCATTCCTTCAGCCTTGAAACCTCTATTCTGCCTGACTTGAGGACCCTG

TCCCCCTCAGAGGAGGCCCAGGGCCTCCTGGGCCTCCCCTCCATGGCGGCAGAGGTGGAGGCCCCAAGAGACCATCTGGCTGCCATGAGGGCTTGTTCTG

CCTGCTCGGGGACATCAGGAGACAATTCTGCCGTCATCTCTGCTCCAGGCAGGTGGGGGTCAGGTGGAGACCCTGCCTGATCCCTTTTCCCTTCACCCTC

GGCTCCTCCCTCCTCCCCACACTCTCCACTCACCACAGACCACCTCAACGACTCCTGGCCCTCCTGAGAAAAAAGAAAACAGAAAAGTGGGGTTTTTTCT

CTTTTCTTTTTTTCACCCTTCCCCCCCTGCCCTTGCCCACAGGGCCTTTTTGTTGAAGTGGGGTATGGAGAGCCAGGAACTGAAGTCCCCCAAAAAAGGG

ATTTTATTTTTTTGAATTTTAATTGTAACGTTTTT
Translation
MARRGWGRIPEPCAAAFPEAVAEDDAFLPGPPTVSAFLSSTTPMPYRRLRLFRGSVQDWGRQAWAG - UNI16742 - GLEAENGPTPSPGRSPLDSQ

ASPGLMLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVASEA AHGEDLIVTPFAQ - UNI24667 - VLASLRNVRSNFSLLTNVPIPSNK KR

SPLGGPPSVCKATLSE EETCQQLARETLEELDWCLEQLETMQTYRSVSEMASHK FKRMLNRELTHLSEMSRSGNQVSEYISNTFLD DKQHEVEIPSP

TPRQRPFQQPPPAAVQQAQPMSQITGLKKLVHTGSLNINVPRFGVKTDQEDLLAQ ELENLSKWGLNIFCVSEYAGGRSLSCIMYTIFQ ERDLLKKFHI

PVDTMMTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALD AVFTDLEILAALFAAAIHDVDHPGVSNQFLINTN NSELALMYNDESVLENHHL

AVGFKLLQEENCDIFQNLSKRQRQSLRKMVIDM VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQ VLRNMVHCADLSNPTKPLELYRQW

TDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQ - UNI20710 - VGFIDYIVHPLWETWADLVHPDAQDILDTLEDNRDWYHSAIRQSPSPTL

EEEPGVLSDPALPDKFQFELTLEEEDEEDSLEVPGLPCTEETLLAPHDTRAQAMEQSKVKGQSPAVVEVAESLKQETASAHGAPEESAEAVGHSFSLETS

ILPDLRTLSPSEEAQGLLGLPSMAAEVEAPRDHLAAMRACSACSGTSGDNSAVISAPGRWGSGGDPA
Transcript ENSMUST00000039413
Sequence
GGCTGGCGCCGGGTTCCGAGAGCGCAGCGGGCTCCAAGCGCCAGGAGGACACCGGCGCCGCCGCCGTCCGCGTTCTCCGTCCTTGGGCGCCATGGCCCCA

CTGAGGCCAGGAGCTCCCGTGGGTCCCCAAGCACCTCGGCCGTGGCGCCACTGAGCTCGGACAGGCCAGGGGACGTTTTTGCCCCCGGGCACCCCACAAG

ACAGAGCGGGAGCCATGGAGCCTCCGGCCGCCCCCTCGGAGAGGAGCCTGTCTCTCTCTCTTCCCGGGCCCCGAGAGGGCCAGGCCACCCTGAAGCCGCC

CCCCCAGCACCTGTGGCGGCAGCCGAGGACCCCGATCCGCATCCAGCAGCGCGGCTACTCGGACAGTGCCGAGCGCTCAGAGCCAGAGCGCTCGCCGCAC

CGGCCCATAGAGCGCGCCGACGCCGTGGACACTGGCGACCGGCCAGGCCTGCGGACTACCCGCATGTCCTGGCCCTCGTCCTTCCACGGCACCGGTACCG

GCGGAGGCAGCAGTAGGCG - UNI16742 - - UNI33768 - CTTGGAGGCAGAAAATGGGCCAACACCGTCCCCTGGCCGCAGCCCCCTGGACTC

GCAGGCGAGCCCGGGGCTTATGCTGCATGCCGGGGCAGCCACCAGCCAGCGCCGAGAATCCTTCCTCTATCGCTCAGACAGCGACTATGACATGTCACCG

AAGACTATGTCCAGGAACTCATCCGTCGCCAGCGAAGC GCATGGTGAAGACCTCATTGTGACCCCGTTTGCCCAG - UNI24667 - GTGCTGGCCA

GTCTCCGCAACGTTCGAAGCAACTTCTCACTCCTAACCAATGTGCCCATCCCCAGCAACAA GAGGTCCCCGCTGGGCGGGCCACCCTCTGTCTGCAAGG

CCACACTGTCAG AGGAGACATGCCAGCAGCTGGCCCGGGAGACCCTGGAAGAGCTGGATTGGTGCCTGGAGCAGCTGGAGACCATGCAGACCTACCGCT

CTGTCAGCGAGATGGCCTCACACAAG TTTAAAAGGATGCTGAACCGGGAACTCACACACCTGTCGGAAATGAGCAGGTCAGGAAACCAGGTCTCAGAGT

ACATTTCCAACACGTTCCTAG ACAAGCAGCACGAAGTGGAGATCCCATCGCCCACGCCGCGACAGAGACCCTTCCAGCAGCCCCCACCAGCAGCAGTGC

AGCAGGCCCAGCCCATGTCTCAGATCACAGGGCTGAAAAAGCTGGTACACACCGGAAGCTTGAACATCAATGTCCCACGATTTGGAGTCAAGACAGATCA

GGAGGACCTCTTAGCACAA GAACTGGAGAACTTGAGCAAATGGGGCCTGAACATCTTTTGTGTGTCGGAGTACGCTGGAGGCCGTTCACTCAGCTGTAT

CATGTATACGATATTCCAG GAGCGGGACTTACTGAAGAAATTCCACATCCCCGTGGACACCATGATGACATACATGCTGACGCTGGAGGACCACTACCA

CGCTGACGTGGCCTACCACAACAGCCTGCACGCAGCCGATGTGCTACAGTCCACACATGTGCTGCTGGCCACGCCTGCACTGGAT GCCGTGTTCACAGA

CCTGGAGATTCTTGCTGCTCTCTTCGCTGCTGCCATCCATGACGTGGACCACCCTGGCGTCTCCAACCAGTTCCTAATCAACACCA ATTCGGAGCTGGC

ATTGATGTACAACGATGAGTCTGTGCTTGAGAACCACCACCTGGCTGTGGGATTCAAGCTGCTGCAAGAAGAGAACTGCGACATCTTCCAGAACCTCAGC

AAGCGCCAGCGGCAGAGCCTGCGCAAGATGGTCATCGACATG GTGCTGGCCACAGACATGTCCAAGCACATGACCCTTCTGGCTGACCTGAAGACTATG

GTAGAGACGAAGAAAGTGACCAGCTCTGGAGTTCTCTTGCTGGACAACTACTCTGACCGTATCCAG GTCCTCAGGAACATGGTGCACTGTGCAGACCTC

AGCAATCCCACCAAGCCCCTGGAGCTGTACCGACAATGGACTGATCGCATCATGGCTGAGTTCTTCCAGCAGGGTGACCGAGAACGGGAACGCGGAATGG

AGATTAGCCCCATGTGTGACAAGCACACAGCCTCTGTGGAGAAGTCTCAG - UNI20710 - GTGGGCTTCATCGACTATATTGTTCACCCACTGTGG

GAGACGTGGGCCGATCTCGTCCACCCCGATGCCCAAGACATCCTGGACACGCTGGAAGACAACCGGGATTGGTATCACAGTGCCATCCGCCAGAGTCCCT

CCCCAACCCTGGAAGAGGAGCCAGGAGTGCTCAGCGATCCGGCCCTGCCTGACAAGTTCCAATTTGAGCTCACCTTGGAGGAAGAGGATGAAGAGGATTC

ATTGGAGGTTCCAGGATTGCCTTGCACTGAGGAAACTCTCCTGGCTCCACATGATACCAGAGCTCAAGCCATGGAACAGTCAAAGGTCAAAGGCCAGAGC

CCTGCTGTTGTGGAGGTAGCAGAGAGTTTGAAGCAGGAGACAGCCTCAGCACATGGCGCTCCTGAGGAGTCCGCGGAGGCTGTGGGCCATTCCTTCAGCC

TTGAAACCTCTATTCTGCCTGACTTGAGGACCCTGTCCCCCTCAGAGGAGGCCCAGGGCCTCCTGGGCCTCCCCTCCATGGCGGCAGAGGTGGAGGCCCC

AAGAGACCATCTGGCTGCCATGAGGGCTTGTTCTGCCTGCTCGGGGACATCAGGAGACAATTCTGCCGTCATCTCTGCTCCAGGCAGGTGGGGGTCAGGT

GGAGACCCTGCCTGATCCCTTTTCCCTTCACCCTCGGCTCCTCCCTCCTCCCCACACTCTCCACTCACCACAGACCACCTCAACGACTCCTGGCCCTCCT

GAGAAAAAAGAAAACAGAAAAGTGGGGTTTTTTCTCTTTTCTTTTTTTCACCCTTCCCCCCCTGCCCTTGCCCACAGGGCCTTTTTGTTGAAGTGGGGTA

TGGAGAGCCAGGAACTGAAGTCCCCCAAAAAAGGGATTTTATTTTTTTGAATTTTAATTGTAACGTTTTT
Translation
MEPPAAPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERSEPERSPHRPIERADAVDTGDRPGLRTTRMSWPSSFHGTGTGGGSS

RR - UNI16742 - - UNI33768 - RLEAENGPTPSPGRSPLDSQASPGLMLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVASEA AHGED

LIVTPFAQ - UNI24667 - VLASLRNVRSNFSLLTNVPIPSNK KRSPLGGPPSVCKATLSE EETCQQLARETLEELDWCLEQLETMQTYRSVSEM

ASHK FKRMLNRELTHLSEMSRSGNQVSEYISNTFLD DKQHEVEIPSPTPRQRPFQQPPPAAVQQAQPMSQITGLKKLVHTGSLNINVPRFGVKTDQED

LLAQ ELENLSKWGLNIFCVSEYAGGRSLSCIMYTIFQ ERDLLKKFHIPVDTMMTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALD AVFTD

LEILAALFAAAIHDVDHPGVSNQFLINTN NSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKRQRQSLRKMVIDM VLATDMSKHMTLLADLK

TMVETKKVTSSGVLLLDNYSDRIQ VLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQ - UNI20710 - 

VGFIDYIVHPLWETWADLVHPDAQDILDTLEDNRDWYHSAIRQSPSPTLEEEPGVLSDPALPDKFQFELTLEEEDEEDSLEVPGLPCTEETLLAPHDTRA

QAMEQSKVKGQSPAVVEVAESLKQETASAHGAPEESAEAVGHSFSLETSILPDLRTLSPSEEAQGLLGLPSMAAEVEAPRDHLAAMRACSACSGTSGDNS

AVISAPGRWGSGGDPA

For any suggestions or comments, please send an email to unitrap@crg.es