Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032180 (Tmed1)
Chromosomal location
Chr 9: 21312001 - 21314631 (-)
Description
transmembrane emp24 domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:106201]
Human Ortholog
not available
Omim not available
UniTrap UNI35426
Vector Insertion
Chr 9: 21313697 - 21314632
Public Clones IST14678C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098951
Sequence
GGGTGACCCGGATGATGGCGGCCGGCGCGGCCGTAGCACTGGCCCTGTGGCTACTCCTGCCAGCAGTAGGAGTGGGAGAGGCAGGGCCGCCGCCTATCCA

GGACGGCGAGTTCACATTTCTGCTTCCCGCCGGGAGAAAGCAGTGTTTCTATCAGTCCGCACCGGCCAATGCTAGTCTTGAGACCGAGTACCAG - UNI

35426 - GGTGGAGCCTACTGAGGCCGGAGACTACAGGCTGTGCTTTGACAACTCCTTCAGCACCATCTCAGAAAAGCTTGTGTTCTTTGAGCTCATCT

TTGACAGCTTCCAAGATGAGGAGGAGGTAGAAGGTTGGGCGGAGGCTGTGGAGCCAGAAGAGATGCTTGATGTCAAAATGGAAGACATCAAG GAATCCA

TAGAGACCATGAGGACCCGGCTGGAACGGAGCATCCAGATGCTCACTCTGCTCCGAGCCTTTGAGGCTCGTGATCGAAATCTTCAAGAAGACAACCTGGA

GCGGGTCAACTTCTGGTCAGCTGCCAATGTGGCTGTGTTGCTGCTGGTGGCTGTCCTGCAAGTCTGCACACTCAAGCGCTTCTTCCATGACAAGCGCCCT

GTACCCACGTAGCCCCTGCCACAGAGGATGAGGGCAGCGGGTGTGTGACTTGCTGGACACCTCCCAGACTCAGATGAGACACTACATAGTTGGGTCCTTA

GCAGTGGCCCCATGTGTCTCCCTTCCTCAGTGACCAGGGAGTGCCAATGGCTCACAGACCCCTCGGAAGGGGGAGGGCTCAGCGACTGTGCCTGTTCCTT

GGAGGGTGGAAGTGCTGGGCGCAGCAGTGTGGGGACACTGCTCTTGGATGCCCTGGCTTTCTCCTGAAATCGTGCCTTAGCTTCAGTCTTGCAGCTATCA

GGATGGGGTGAAGCTGTGGTGCTGCCCCCCACCCTCCAACTAGACACCCCAACTGCAATGTCTCTGCTCTCCTCCTGGGGTAAGCCTACTTCACTAGGGT

CTGGGAAGGAGACACATCTGCAGAGTTCTTGCCAGGACAGTCACTTTTATTTGAAAGGAAGGAGCCCTGGCCCCTTGGCCCAGAGGGGAGCCAGCTAGTA

GGTGGTTTGGGAGAGGCCCCTTCCTTCTCTCTGGGTGCAGGGCCTCAGAGAAGGCTGGCCCATGAGCCTCAAGGAACAGAGGGCATTTGTCCTGGGCACT

GGAGTCAATAAATTATGGTCAGAAAGTT
Translation
MLVLRPSTR - UNI35426 - RVEPTEAGDYRLCFDNSFSTISEKLVFFELIFDSFQDEEEVEGWAEAVEPEEMLDVKMEDIK ESIETMRTRLERSI

QMLTLLRAFEARDRNLQEDNLERVNFWSAANVAVLLLVAVLQVCTLKRFFHDKRPVPT
Transcript ENSMUST00000034698
Sequence
GGGTGACCCGGATGATGGCGGCCGGCGCGGCCGTAGCACTGGCCCTGTGGCTACTCCTGCCAGCAGTAGGAGTGGGAGAGGCAGGGCCGCCGCCTATCCA

GGACGGCGAGTTCACATTTCTGCTTCCCGCCGGGAGAAAGCAGTGTTTCTATCAGTCCGCACCGGCCAATGCTAGTCTTGAGACCGAGTACCAG - UNI

35426 - GTGATCGGAGGTGCTGGGCTGGACGTGGACTTCACCTTGGAGAGCCCTCAGGGTGTGCTGTTGGTCAGTGAGTCTCGAAAGGCTGATGGGGT

ACACAC - UNI35426 - GGTGGAGCCTACTGAGGCCGGAGACTACAGGCTGTGCTTTGACAACTCCTTCAGCACCATCTCAGAAAAGCTTGTGTTCT

TTGAGCTCATCTTTGACAGCTTCCAAGATGAGGAGGAGGTAGAAGGTTGGGCGGAGGCTGTGGAGCCAGAAGAGATGCTTGATGTCAAAATGGAAGACAT

CAAG GAATCCATAGAGACCATGAGGACCCGGCTGGAACGGAGCATCCAGATGCTCACTCTGCTCCGAGCCTTTGAGGCTCGTGATCGAAATCTTCAAGA

AGACAACCTGGAGCGGGTCAACTTCTGGTCAGCTGCCAATGTGGCTGTGTTGCTGCTGGTGGCTGTCCTGCAAGTCTGCACACTCAAGCGCTTCTTCCAT

GACAAGCGCCCTGTACCCACGTAGCCCCTGCCACAGAGGATGAGGGCAGCGGGTGTGTGACTTGCTGGACACCTCCCAGACTCAGATGAGACACTACATA

GTTGGGTCCTTAGCAGTGGCCCCATGTGTCTCCCTTCCTCAGTGACCAGGGAGTGCCAATGGCTCACAGACCCCTCGGAAGGGGGAGGGCTCAGCGACTG

TGCCTGTTCCTTGGAGGGTGGAAGTGCTGGGCGCAGCAGTGTGGGGACACTGCTCTTGGATGCCCTGGCTTTCTCCTGAAATCGTGCCTTAGCTTCAGTC

TTGCAGCTATCAGGATGGGGTGAAGCTGTGGTGCTGCCCCCCACCCTCCAACTAGACACCCCAACTGCAATGTCTCTGCTCTCCTCCTGGGGTAAGCCTA

CTTCACTAGGGTCTGGGAAGGAGACACATCTGCAGAGTTCTTGCCAGGACAGTCACTTTTATTTGAAAGGAAGGAGCCCTGGCCCCTTGGCCCAGAGGGG

AGCCAGCTAGTAGGTGGTTTGGGAGAGGCCCCTTCCTTCTCTCTGGGTGCAGGGCCTCAGAGAAGGCTGGCCCATGAGCCTCAAGGAACAGAGGGCATTT

GTCCTGGGCACTGGAGTCAATAAATTATGGTCAGAAAGTT
Translation
MMAAGAAVALALWLLLPAVGVGEAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQ - UNI35426 - VIGGAGLDVDFTLESPQGVLLVSES

RKADGVHT - UNI35426 - TVEPTEAGDYRLCFDNSFSTISEKLVFFELIFDSFQDEEEVEGWAEAVEPEEMLDVKMEDIK ESIETMRTRLERSIQ

MLTLLRAFEARDRNLQEDNLERVNFWSAANVAVLLLVAVLQVCTLKRFFHDKRPVPT

For any suggestions or comments, please send an email to unitrap@crg.es