Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032184 (Lysmd2)
Chromosomal location
Chr 9: 75473548 - 75485578 (+)
Description
LysM, putative peptidoglycan-binding, domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:1917332]
RefSeq_dna
NM_027309 
RefSeq_peptide
NP_081585.2 
UniGene
Mm.391671 
MGI
MGI:1917332 
Uniprot/SWISSPROT
Q9D7V2 
Human Ortholog
ENSG00000140280 (LYSMD2)
Omim not available
UniTrap UNI28814
Vector Insertion
Chr 9: 75483525 - 75485018
Public Clones not available
Private Clones OST19310 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034702
Sequence
GCCCGGGCGGCCTTGGCAGGACCCATGGCGGATCTCTCGCCTGCGCCGGCCCTGCGGGAAGGCGGCCCCCGTGCGCACCGGCCCTCGGCGCCCTCCCCTC

CGCCGCGCTCTCGCTCCACCTCGGAGCCCGAGGAGGCCGAGCTGTCGCTGAGCCTGGCCCGCACCAAGACCCGCTCGTACGGCAGCACGGCCAGCGTGCG

GGCGCCTCTGGGCGCCGGCGTCATCGAGCGCCATGTGGAGCACCGGGTCCGCGCCGGGGACACGCTTCAGGGCATCGCGCTCAAGTACGGAGTCACG AT

GGAACAGATCAAAAGGGCCAACAAACTGTTTACCAATGACTGTATATTTCTGAAGAAGACGCTGAGCATCCCAATCCTGTCGGAGAAGCCTTTGCTGTTT

AATGGACTTAACTCCATTGATTCTCCGGAAAGTGAAACTGTCGACAGCAGCTTTTGTCAGGAAGAGGAGCCTGTAGTGTCTGAGGAAGAACTGCCCCCTC

CCAGTCCTCAGGACCCGGACCCCAAGCCTGCGCAACCCGAGGAAGTGTCTGCCAGAGATTTCCTGCAAAGACTGGACTTACAGATTAAACTCTCAACACA

GGCAGCCAGGAAACTCAAAGAAGAGAGCAG - UNI28814 - GGATGAAGAGAGTCCCTATGCTGCCTCTCTTTATCATAGTTAGTGACTGGCCAGCG

GACTGATCCAGATCACAGAATGGCTGGACCCTAAAGAACCCGCCGGCTCTGGTTCAGGGGCAGCGCTGCCCCTGGACTCCCGTAGCGCACCTTCGAGCTG

CAGTTAAGTAGCCCTACTGCAGCTTGCCTGAAGTGATCAGCTCCCGGCTTTCTATAGTTAAGTCTTATTACGGCATGATAGCAAAACTGTATTTATTCTA

ACGCCTTTCACTTTTGTAGATGGTGGTAGTTTTAGACCGGCTTTTGTAGATACAGAAAGCATCAGAGACTCTATATATTTAAGCCAAAAGCTATGTTTAT

TTCCTGATGAGATCCTAAATGTGTGGAAGACATGATGACTGTGGAGTGATAATGCATTTGCTGTGTGTTTATAACTCAAGTGCTATAGTATATATTTCAA

TATCACATATTCTGTACTAATGTAAAGAACCAAATTTTGTCTGCTATTTTGTAAAAGTAAACTACAGATGTCTGGATGAGAAAATAAACTATGTTTTCAC

ACAG
Translation
MADLSPAPALREGGPRAHRPSAPSPPPRSRSTSEPEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKYGVT MEQIKRAN

KLFTNDCIFLKKTLSIPILSEKPLLFNGLNSIDSPESETVDSSFCQEEEPVVSEEELPPPSPQDPDPKPAQPEEVSARDFLQRLDLQIKLSTQAARKLKE

ESR - UNI28814 - RDEESPYAASLYHS

For any suggestions or comments, please send an email to unitrap@crg.es