Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032193 (Ldlr)
Chromosomal location
Chr 9: 21528038 - 21554360 (+)
Description
low density lipoprotein receptor Gene [Source:MGI Symbol;Acc:MGI:96765]
RefSeq_dna
NM_010700 
RefSeq_peptide
NP_034830.2 
UniGene
Mm.469604 Mm.3213 
MGI
MGI:96765 
Uniprot/SWISSPROT
P35951 
Uniprot/SPTREMBL
Q3TDD1 Q3TVR4 Q3U8R7 Q6GTJ9 Q8VCT0 Q91ZJ1 
Human Ortholog
ENSG00000130164 (LDLR)
Omim 143890 - HYPERCHOLESTEROLEMIA, AUTOSOMAL DOMINANT  
UniTrap UNI11543
Vector Insertion
Chr 9: 21528289 - 21536190
Public Clones W167A03 (ggtc) W167C03 (ggtc) (ggtc) P022D12 (ggtc) D031F01 (ggtc)
IST12801B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9146
Vector Insertion
Chr 9: 21536879 - 21537934
Public Clones XST108 (baygenomics) XST128 (baygenomics) RST527 (baygenomics) KST285 (baygenomics)
Private Clones OST60703 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10288
Vector Insertion
Chr 9: 21538319 - 21539680
Public Clones LST106 (baygenomics) G055F09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9032
Vector Insertion
Chr 9: 21539804 - 21541663
Public Clones RST575 (baygenomics) RST562 (baygenomics) G037E12 (ggtc) G055G09 (ggtc)
G037D12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9492
Vector Insertion
Chr 9: 21547241 - 21548365
Public Clones RST050 (baygenomics) IST11709F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9808
Vector Insertion
Chr 9: 21548830 - 21550175
Public Clones PST059 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10133
Vector Insertion
Chr 9: 21550884 - 21551592
Public Clones XST117 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000070068
Sequence
TGGAAACCTCGCCCCTAGTACTGGGAATGACTCTGGGCGTGCGGCGTAGTTTGCAGCCGGGACACCGTGAGGCTTGCGAGCCCAGATTCGCAGCCGAGAC

ACCGTGGGGCCCGCGATCCAGTGTTTGCAGCGGGAACATTTCGGGGTCTGTGATCCGAGTGAGGACGCAACGCAGAAGCTAAGGATGAGCACCGCGGATC

TGATGCGTCGCTGGGTCATCGCCCTGCTCCTGGCTGCTGCCGGAGTTGCAG - UNI11543 - CAGAAGACTCATGCAGCAGGAACGAGTTCCAGTGT

AGAGACGGAAAATGCATCGCTAGCAAGTGGGTGTGCGATGGCAGCCCCGAGTGCCCGGATGGCTCCGATGAGTCCCCAGAGACATGCA TGTCTGTCACC

TGTCAGTCCAATCAATTCAGCTGTGGAGGCCGTGTCAGCCGATGCATTCCTGACTCCTGGAGATGTGATGGACAGGTAGACTGTGAAAATGACTCAGACG

AACAAGGCTGTC - UNI9146 - CCCCCAAGACGTGCTCCCAGGATGACTTCCGATGCCAGGATGGCAAGTGCATCTCCCCGCAGTTTGTGTGTGATG

GAGACCGAGATTGCCTAGATGGCTCTGATGAGGCCCACTGCCAGGCCACCACTTGTGGCCCCGCCCACTTCCGCTGCAACTCATCCATATGCATCCCCAG

TCTTTGGGCCTGCGACGGGGATGTCGACTGTGTTGACGGCTCCGATGAGTGGCCACAGAACTGCCAGGGCCGAGACACGGCCTCCAAAGGCGTTAGCAGC

CCCTGCTCCTCCCTGGAGTTCCACTGTGGTAGCAGTGAGTGTATCCATCGCAGCTGGGTCTGTGACGGCGAGGCAGACTGCAAGGACAAGTCAGATGAGG

AGCACTGCG - UNI10288 - CGGTGGCCACCTGCCGACCTGATGAATTCCAGTGTGCAGATGGCTCCTGCATTCACGGTAGCCGCCAGTGTGACCGT

GAACATGACTGCAAGGACATGAGCGACGAGCTCGGCTGCGTCAATG - UNI9032 - TGACACAGTGTGATGGCCCCAACAAGTTCAAGTGTCACAGT

GGGGAGTGCATCAGCTTGGACAAGGTGTGCGACTCCGCCCGCGACTGCCAGGACTGGTCGGATGAGCCCATCAAGGAGTGCA AGACCAACGAGTGTTTG

GACAACAATGGTGGCTGTTCCCACATCTGCAAGGACCTCAAGATTGGCTCTGAGTGCCTGTGTCCCAGCGGCTTCCGGTTGGTGGACCTCCACAGGTGTG

AAG ATATTGACGAGTGTCAGGAGCCAGACACCTGCAGCCAGCTCTGTGTGAACCTGGAAGGCAGCTACAAGTGTGAGTGCCAGGCCGGCTTCCACATGG

ACCCACACACCAGGGTCTGCAAGGCTGTGG GCTCCATAGGCTATCTGCTCTTCACCAACCGCCACGAGGTCCGGAAGATGACCCTGGACCGCAGCGAGT

ACACCAGTCTGCTCCCCAACCTGAAGAATGTGGTGGCTCTCGACACGGAGGTGACCAACAATAGAATCTACTGGTCCGACCTGTCCCAAAAAAAGATCTA

CAG CGCCCTGATGGACCAGGCCCCTAACTTGTCCTACGACACCATCATCAGTGAGGACCTGCATGCCCCTGACGGGCTGGCGGTAGACTGGATCCACCG

CAACATCTACTGGACAGATTCAGTCCCAGGCAGCGTATCTGTGGCTGACACCAAGGGCGTAAAGAGGAGGACACTGTTCCAAGAGGCAGGGTCCAGACCC

AGAGCCATCGTAGTGGACCCTGTGCATGG CTTCATGTACTGGACAGATTGGGGAACACCCGCCAAGATCAAGAAAGGGGGTTTGAATGGTGTGGACATC

CACTCACTGGTGACCGAAAACATCCAGTGGCCAAATGGCATCACACTAG ATCTTTCCAGTGGCCGTCTCTATTGGGTTGATTCCAAACTCCACTCTATC

TCCAGCATCGATGTCAATGGGGGCAATCGGAAAACCATTTTGGAGGATGAGAACCGGCTGGCCCACCCCTTCTCCTTGGCCATCTATGAG - UNI9492

 - GACAAAGTGTATTGGACAGATGTCATAAACGAAGCCATTTTCAGTGCCAATCGACTCACGGGTTCAGATGTGAATTTGGTGGCTGAAAACCTCTTGT

CCCCGGAGGACATTGTCCTGTTCCACAAGGTCACACAGCCTAGAG - UNI9808 - AAGTCGACACTGTACTGACCACCCAGGGGACATCCGCCGTCC

GGCCTGTGGTCACCGCATCAGCTACCAGGCCACCGAAGCACAGTGAGGATCTCTCAGCTCCCAGTACTCCTAGGCAGCCTGTGGACACCCCAGGGCTCAG

CACAGTGGCGTCAGTGACAGTGTCCCACCAAG TCCAGGGTGACATGGCTGGCAGAGGGAATGAGGAGCAGCCACATGGTATGAGGTTCCTGTCCATCTT

CTTCCCTATTG - UNI10133 - CACTGGTTGCCCTCCTTGTCCTTGGGGCCGTCCTGCTGTGGAGGAACTGGCGGCTGAAGAACATCAACAGCATAA

ACTTTGACAACCCAGTCTACCAGAAGACCACAGAGGACGAGCTCCACATTTGCCGAAGCCAGGATGGCTATACCTACCCCTCA AGACAGATGGTCAGCC

TGGAGGACGATGTGGCATGAGCAGCCGGGAGAGCCGTCTCTTTCCGGGATCCATTGCCAAGCTTAGGCAGAAAAGACACTCTCTCCAGACCTCCCCATCC

AGCACTGGTCCTGCCACCTCCCTGGGCTCTGTGTTGCTCAAAGCAAGATAAGAGCAAAGCTGGGCTGGGGGCCAAGCTCAGCTGCCTGTCTGCCCCAGGT

TCTGTTTTATATATTTATTGTCTGGGGACAGAAAAGGCTACTGGCTGTGCTTGAAATTCGAATTCTGCCTGGGAATTTTTTTTTTTCTCCCATCTTCATT

TCCTTGGAAGCCAAATAGGCTGTCCCAGAAGCTTCTGAATTCTACTCTTTTCAACACTAACACGGAGGAGGAAGAGACCCACCCAGGCAGAGAGAAGCCT

GCTGGACATGAGACAGCAGGTACTACTGACCGGGTCCTGGGTACCATAGCCAGTCCCTAACCTCAGGACTTCCTGCATTGACCTTCATCCCAGAGCCTTC

CTGCCTGACTCTGCCGCCCCCATCAGAAGCCAGGAAAGTGACTCGTGACATTCGGTACTGATCTTGCTGGATCTTGAGGCCGGCAGCTGCCAGTGATGGA

TACCCGCTCATGCCTTTGCCAAAACGTCACCCGTTCCTGGAGGGACAAGCCCAAGTCGCCATTCTCCCTTAATATTTATCAAGTGCCTGAGACAACTGGT

TGCCTTGCTCAGGAGTCCTGGCCTGCTCAGTGTCCTGCTGCTCAGGGGTGGCCGGCAGGACCCCTGTCCTGTGCCCAGCCCCCGAGTCTCCGAGTGAGGC

TTGCACTTCTCTCTGCGCACTTTTCCCGTTCTGTGCTGGGCACCCACGTGGTCCACATTTGTACTCCTAGGTTGCACTGACCCTGGTGCATTGGATGGGA

CCTCAGGCCGGAAGTGGCCCCGAATCATTGACCACAGAAGATAATTGCCAGGCTCCAAGCATCCATTGCCTTCTTCAGTACTGGGGGGAACTCAGGGCCT

CTGTCTGGTGTTTAGTTAGTCTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGGTGGTTTCTGGCTCTGCACAGCAGAGTTGTTTAGCTCCTCTGGTAACGT

CATCCTCTCTCACAGAGACATCCAGCCTGCTGAAGGGGAGAGATGGGGCGAGGGGAGGGATACACGCATGGTTTCTCAGGTGTGGTGGCACTTGGCTTTA

ATCCTATGCTCAAGAGGAAGAGGTGGGCACATGTCTGAGGTCCAAGCCTACATAGTGAGACCTTATATATCTAAAAACCAAAAGAAATCCCAGACTATTT

GGTGGGACTTGGAAGAATACTTAGAAATTGCCACAGATTTGTCACATGGGTAACCTAAGAAGACAGTGGTGGCCTTACTTGGATTCCTGGGTAGATCCAC

CTGTCCACTACTCAAGACACAAGGGCACACTGCCCAGCCCACTGGGACACTTGTAAAGAGCTCTGTAATGTGCCGATGGCACCTGGCTCGGTTTTCATTC

TGTATATTCAAGGATATCACACATATGTATTAAATCTATTTATTTTTGCAAACCCTGATTGCTGCACCTCTCTGCAATTTCTCCAGGTTAGGCTGGGGTG

ATACTCTGGGATGCTCTGTATACAAAGATGATTTGAATGGGCTGATCTCAGGCCTGTCCTGTGCGTTGCTTTGAGTGGGTGGGAACTGCTTTGAAACCCT

TGTTCAGATGTTTTTATAGGCTGAAAATATCATACTGTGATGGATTAAATTCTTTTTTGG
Translation
MSTADLMRRWVIALLLAAAGVAA - UNI11543 - AEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCM MSVTCQSNQFSCGGRVSRCI

PDSWRCDGQVDCENDSDEQGCP - UNI9146 - PPKTCSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDG

DVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCA - UNI10288 - AVATCRPDEFQCADGSCIHGSR

QCDREHDCKDMSDELGCVNV - UNI9032 - VTQCDGPNKFKCHSGECISLDKVCDSARDCQDWSDEPIKECK KTNECLDNNGGCSHICKDLKIGSE

CLCPSGFRLVDLHRCED DIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVG GSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNVVALD

TEVTNNRIYWSDLSQKKIYS SALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHG GF

MYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLD DLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYE - UNI9492 - 

DKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRE - UNI9808 - EVDTVLTTQGTSAVRPVVTASATRPPKHSEDLSAPSTPR

QPVDTPGLSTVASVTVSHQV VQGDMAGRGNEEQPHGMRFLSIFFPIA - UNI10133 - ALVALLVLGAVLLWRNWRLKNINSINFDNPVYQKTTED

ELHICRSQDGYTYPS RQMVSLEDDVA
Transcript ENSMUST00000034713
Sequence
TGGAAACCTCGCCCCTAGTACTGGGAATGACTCTGGGCGTGCGGCGTAGTTTGCAGCCGGGACACCGTGAGGCTTGCGAGCCCAGATTCGCAGCCGAGAC

ACCGTGGGGCCCGCGATCCAGTGTTTGCAGCGGGAACATTTCGGGGTCTGTGATCCGAGTGAGGACGCAACGCAGAAGCTAAGGATGAGCACCGCGGATC

TGATGCGTCGCTGGGTCATCGCCCTGCTCCTGGCTGCTGCCGGAGTTGCAG - UNI11543 - CAGAAGACTCATGCAGCAGGAACGAGTTCCAGTGT

AGAGACGGAAAATGCATCGCTAGCAAGTGGGTGTGCGATGGCAGCCCCGAGTGCCCGGATGGCTCCGATGAGTCCCCAGAGACATGCA TGTCTGTCACC

TGTCAGTCCAATCAATTCAGCTGTGGAGGCCGTGTCAGCCGATGCATTCCTGACTCCTGGAGATGTGATGGACAGGTAGACTGTGAAAATGACTCAGACG

AACAAGGCTGTC - UNI9146 - CCCCCAAGACGTGCTCCCAGGATGACTTCCGATGCCAGGATGGCAAGTGCATCTCCCCGCAGTTTGTGTGTGATG

GAGACCGAGATTGCCTAGATGGCTCTGATGAGGCCCACTGCCAGGCCACCACTTGTGGCCCCGCCCACTTCCGCTGCAACTCATCCATATGCATCCCCAG

TCTTTGGGCCTGCGACGGGGATGTCGACTGTGTTGACGGCTCCGATGAGTGGCCACAGAACTGCCAGGGCCGAGACACGGCCTCCAAAGGCGTTAGCAGC

CCCTGCTCCTCCCTGGAGTTCCACTGTGGTAGCAGTGAGTGTATCCATCGCAGCTGGGTCTGTGACGGCGAGGCAGACTGCAAGGACAAGTCAGATGAGG

AGCACTGCG - UNI10288 - CGGTGGCCACCTGCCGACCTGATGAATTCCAGTGTGCAGATGGCTCCTGCATTCACGGTAGCCGCCAGTGTGACCGT

GAACATGACTGCAAGGACATGAGCGACGAGCTCGGCTGCGTCAATG - UNI9032 - TGACACAGTGTGATGGCCCCAACAAGTTCAAGTGTCACAGT

GGGGAGTGCATCAGCTTGGACAAGGTGTGCGACTCCGCCCGCGACTGCCAGGACTGGTCGGATGAGCCCATCAAGGAGTGCA AGACCAACGAGTGTTTG

GACAACAATGGTGGCTGTTCCCACATCTGCAAGGACCTCAAGATTGGCTCTGAGTGCCTGTGTCCCAGCGGCTTCCGGTTGGTGGACCTCCACAGGTGTG

AAG ATATTGACGAGTGTCAGGAGCCAGACACCTGCAGCCAGCTCTGTGTGAACCTGGAAGGCAGCTACAAGTGTGAGTGCCAGGCCGGCTTCCACATGG

ACCCACACACCAGGGTCTGCAAGGCTGTGG GCTCCATAGGCTATCTGCTCTTCACCAACCGCCACGAGGTCCGGAAGATGACCCTGGACCGCAGCGAGT

ACACCAGTCTGCTCCCCAACCTGAAGAATGTGGTGGCTCTCGACACGGAGGTGACCAACAATAGAATCTACTGGTCCGACCTGTCCCAAAAAAAGATCTA

CAG CGCCCTGATGGACCAGGCCCCTAACTTGTCCTACGACACCATCATCAGTGAGGACCTGCATGCCCCTGACGGGCTGGCGGTAGACTGGATCCACCG

CAACATCTACTGGACAGATTCAGTCCCAGGCAGCGTATCTGTGGCTGACACCAAGGGCGTAAAGAGGAGGACACTGTTCCAAGAGGCAGGGTCCAGACCC

AGAGCCATCGTAGTGGACCCTGTGCATGG CTTCATGTACTGGACAGATTGGGGAACACCCGCCAAGATCAAGAAAGGGGGTTTGAATGGTGTGGACATC

CACTCACTGGTGACCGAAAACATCCAGTGGCCAAATGGCATCACACTAG ATCTTTCCAGTGGCCGTCTCTATTGGGTTGATTCCAAACTCCACTCTATC

TCCAGCATCGATGTCAATGGGGGCAATCGGAAAACCATTTTGGAGGATGAGAACCGGCTGGCCCACCCCTTCTCCTTGGCCATCTATGAG - UNI9492

 - GACAAAGTGTATTGGACAGATGTCATAAACGAAGCCATTTTCAGTGCCAATCGACTCACGGGTTCAGATGTGAATTTGGTGGCTGAAAACCTCTTGT

CCCCGGAGGACATTGTCCTGTTCCACAAGGTCACACAGCCTAGAG GGGTGAACTGGTGTGAGACAACAGCCCTCCTCCCCAATGGTGGTTGCCAGTACC

TGTGCCTGCCCGCCCCACAGATCGGTCCCCACTCGCCCAAATTCACCTGCGCCTGCCCTGATGGCATGCTGCTGGCCAAGGACATGCGGAGCTGCCTCAC

AG - UNI9808 - AAGTCGACACTGTACTGACCACCCAGGGGACATCCGCCGTCCGGCCTGTGGTCACCGCATCAGCTACCAGGCCACCGAAGCACAG

TGAGGATCTCTCAGCTCCCAGTACTCCTAGGCAGCCTGTGGACACCCCAGGGCTCAGCACAGTGGCGTCAGTGACAGTGTCCCACCAAG TCCAGGGTGA

CATGGCTGGCAGAGGGAATGAGGAGCAGCCACATGGTATGAGGTTCCTGTCCATCTTCTTCCCTATTG - UNI10133 - CACTGGTTGCCCTCCTTG

TCCTTGGGGCCGTCCTGCTGTGGAGGAACTGGCGGCTGAAGAACATCAACAGCATAAACTTTGACAACCCAGTCTACCAGAAGACCACAGAGGACGAGCT

CCACATTTGCCGAAGCCAGGATGGCTATACCTACCCCTCA AGACAGATGGTCAGCCTGGAGGACGATGTGGCATGAGCAGCCGGGAGAGCCGTCTCTTT

CCGGGATCCATTGCCAAGCTTAGGCAGAAAAGACACTCTCTCCAGACCTCCCCATCCAGCACTGGTCCTGCCACCTCCCTGGGCTCTGTGTTGCTCAAAG

CAAGATAAGAGCAAAGCTGGGCTGGGGGCCAAGCTCAGCTGCCTGTCTGCCCCAGGTTCTGTTTTATATATTTATTGTCTGGGGACAGAAAAGGCTACTG

GCTGTGCTTGAAATTCGAATTCTGCCTGGGAATTTTTTTTTTTCTCCCATCTTCATTTCCTTGGAAGCCAAATAGGCTGTCCCAGAAGCTTCTGAATTCT

ACTCTTTTCAACACTAACACGGAGGAGGAAGAGACCCACCCAGGCAGAGAGAAGCCTGCTGGACATGAGACAGCAGGTACTACTGACCGGGTCCTGGGTA

CCATAGCCAGTCCCTAACCTCAGGACTTCCTGCATTGACCTTCATCCCAGAGCCTTCCTGCCTGACTCTGCCGCCCCCATCAGAAGCCAGGAAAGTGACT

CGTGACATTCGGTACTGATCTTGCTGGATCTTGAGGCCGGCAGCTGCCAGTGATGGATACCCGCTCATGCCTTTGCCAAAACGTCACCCGTTCCTGGAGG

GACAAGCCCAAGTCGCCATTCTCCCTTAATATTTATCAAGTGCCTGAGACAACTGGTTGCCTTGCTCAGGAGTCCTGGCCTGCTCAGTGTCCTGCTGCTC

AGGGGTGGCCGGCAGGACCCCTGTCCTGTGCCCAGCCCCCGAGTCTCCGAGTGAGGCTTGCACTTCTCTCTGCGCACTTTTCCCGTTCTGTGCTGGGCAC

CCACGTGGTCCACATTTGTACTCCTAGGTTGCACTGACCCTGGTGCATTGGATGGGACCTCAGGCCGGAAGTGGCCCCGAATCATTGACCACAGAAGATA

ATTGCCAGGCTCCAAGCATCCATTGCCTTCTTCAGTACTGGGGGGAACTCAGGGCCTCTGTCTGGTGTTTAGTTAGTCTGTTTGTTTGTTTGTTTGTTTG

TTTGTTTGGTGGTTTCTGGCTCTGCACAGCAGAGTTGTTTAGCTCCTCTGGTAACGTCATCCTCTCTCACAGAGACATCCAGCCTGCTGAAGGGGAGAGA

TGGGGCGAGGGGAGGGATACACGCATGGTTTCTCAGGTGTGGTGGCACTTGGCTTTAATCCTATGCTCAAGAGGAAGAGGTGGGCACATGTCTGAGGTCC

AAGCCTACATAGTGAGACCTTATATATCTAAAAACCAAAAGAAATCCCAGACTATTTGGTGGGACTTGGAAGAATACTTAGAAATTGCCACAGATTTGTC

ACATGGGTAACCTAAGAAGACAGTGGTGGCCTTACTTGGATTCCTGGGTAGATCCACCTGTCCACTACTCAAGACACAAGGGCACACTGCCCAGCCCACT

GGGACACTTGTAAAGAGCTCTGTAATGTGCCGATGGCACCTGGCTCGGTTTTCATTCTGTATATTCAAGGATATCACACATATGTATTAAATCTATTTAT

TTTTGCAAACCCTGATTGCTGCACCTCTCTGCAATTTCTCCAGGTTAGGCTGGGGTGATACTCTGGGATGCTCTGTATACAAAGATGATTTGAATGGGCT

GATCTCAGGCCTGTCCTGTGCGTTGCTTTGAGTGGGTGGGAACTGCTTTGAAACCCTTGTTCAGATGTTTTTATAGGCTGAAAATATCATACTGTGATGG

ATTAAATTCTTTTTTGG
Translation
MSTADLMRRWVIALLLAAAGVAA - UNI11543 - AEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCM MSVTCQSNQFSCGGRVSRCI

PDSWRCDGQVDCENDSDEQGCP - UNI9146 - PPKTCSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDG

DVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCA - UNI10288 - AVATCRPDEFQCADGSCIHGSR

QCDREHDCKDMSDELGCVNV - UNI9032 - VTQCDGPNKFKCHSGECISLDKVCDSARDCQDWSDEPIKECK KTNECLDNNGGCSHICKDLKIGSE

CLCPSGFRLVDLHRCED DIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVG GSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNVVALD

TEVTNNRIYWSDLSQKKIYS SALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHG GF

MYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLD DLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYE - UNI9492 - 

DKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRG GVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCL

TE - UNI9808 - EVDTVLTTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVSHQV VQGDMAGRGNEEQPHGMRFLSIFFP

IA - UNI10133 - ALVALLVLGAVLLWRNWRLKNINSINFDNPVYQKTTEDELHICRSQDGYTYPS RQMVSLEDDVA

For any suggestions or comments, please send an email to unitrap@crg.es