Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032199 (Grinl1a)
Chromosomal location
Chr 9: 71326278 - 71333723 (-)
Description
glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A Gene [Source:MGI Symbol;Acc:MGI:107282]
RefSeq_dna
NM_178602 
RefSeq_peptide
NP_848717.1 
UniGene
Mm.21094 Mm.403070 
MGI
MGI:107282 
Uniprot/SWISSPROT
Q6P6I6 
Human Ortholog
not available
Omim not available
UniTrap UNI21491
Vector Insertion
Chr 9: 71331613 - 71333490
Public Clones (egtc)
Private Clones OST329055 (lexicon) OST179660 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034720
Sequence
CTTCCGGGAAAATGGCGACTCCCGCTCGCGCTCCAGAGTCGCCGCCGGCCGCGGAGCCAGCGCCCGCCGTGGGCCCCGCCGGGGATCCCTGCCCGCCGCG

CCAGCCGCAGCCCGTGCGCAATGTTCTCGCTGCCCCGCGGCTTCGAGCCCCCAGCTCCCGAGGACTTGGGGCGGCAGAGTTCGGCGGAGCTGCGGGAGAG

GTTGAGGCGCCAGGAGAGACTTTTGCGCAACGA - UNI21491 - AAAATTCATTTGCAAATTGCCCGACAAAGGTAAAAAGATCTCAGACACAGTTG

CCAAACTGAAAGCTGCCATTTCAGAACGTGAAGAGGTTAGAGGGAGAAGTGAACTGTTTCATCCTGTTAGTGTAGACTGTAAGCTAAGGCAAAAAGCAAC

CACAAGAGCTGACACCGATGTAGACAAGGCCCAGAGTTCTGACCTGATGCTTGATACTTCATCATTAGATCCTGACTGTTCCTCAATAGACATTAAGTCA

TCTAAATCAACCTCAGAAACACAGGGACCTACACATCTCACTCACAGAGGCAATGAAGAGACTTTGGAGGCTGGCTACACAGTAAACAGCAGCCCAGCTG

CCCACATCCGAGCCCGGGCGCCCTCATCCGAAGTTAAGGAGCATCTCCCCCAGCACTCTGTTTCAAGTCAAGAGGAAGAGATCTCCAGCAGCATCGACAG

TCTCTTCATCACTAAATTGCAAAAAATCACAATTGCAGACCAGAGTGAACCCTCAGAAGAAAACACCAGCACTGAGAACTTTCCAGAACTGCAGAGTGAG

ACTCCTAAGAAGCCTCATTACATGAAAGTGCTAGAAATGCGAGCCAGAAACCCAGTGCCCCCTCCTCATAAGTTTAAGACCAATGT GTTACCCACACAA

CAGAGTGACTCACCAAGTCATTGTCAGAGGGGCCAGTCTCCTGCTTCCTCAGAAGAGCAGCGACGAAGGGCTAGGCAGCATCTTGATGATATCACAGCAG

CGCGCCTCCTTCCGCTCCACCACCTGCCTGCACAGCTGCTTTCCATAGAAGAGTCGCTGGCCCTGCAGAGGGAGCAGAAGCAGAATTATGAG GAGATGC

AGGCAAAGCTCGCAGCACAGAAACTGGCCGAGAGACTGAATATTAAAATGCAGAGCTACAATCCAGAAGGGGAGTCTTCAGGGAGATACCGAGAAGTGAG

GGACGAAGCTGATGCCCAGTCCTCGGATGAGTGCTGAAGACAGGGCTGGGACACCCCGAGAGCTGGCTGCAGAGCTCTCATTGGCTCATCGAACTTCCTA

ACAAGTATCAAGACCAGCGTCAGACCTTGTTGAGGGACAGCAGGTTTTTAAGTTACACAAAGGTAGCTACAAAGTAAGAACCCAGTTTGTCTTTCAGAAG

ACGCTCTTCACAGCTTGCACAGTTTAATATGTGAACCTTGTATTTGGCCGTATTGTGTTACAGTTTTGCAGTATGTTGTGCATTGGTCTGATATTTTAGT

GTGAGTAGAGCACACGTTTTCTTTAGCTGCATTTTCCTTATCTGTACTCTTATCAGATAGTGCTGCTTACACCCTTTCTGGTGAAATACTTTGTTACCCC

AGGCACCTAAAGTGAATTAGGAAGGCCTGGTTCCCTCGCTCAAGAAATGAAGTGTAAAGAATGGTCCACGTGCCTGCATGGACATGTTCCTGAGATGCTG

GATGTGAAACACTGTGGAAGACACTCAGAAATGTTACAGCAAGTGCATTGGCTGATCCTGTCTCTCTGGGGTGACTGCTGTCTTCCTAGGATGAGGACAA

GGAGCGCTGAAGAGGTGCTGGGCGGGGGAGGGTCTTCTGAGCTGGTGTGGGGAGCTGCTCCTGGCCTCCCTTGGCTTGAACTCATTGCTGTCTCGATGAT

AGGTCCCTGTACAGGGCGTTCACGTTTGGTAAGGAAACCGATGTTTTTCTAAGAGTTACAGTTGACTTGTGAGTACATTGCTTTTTTCATTTTTAAACCC

AAAGAGGTGTTTATAGGCTGCAGAAACCTCAGTCATGTATGTACACATTTGTGTTGTTTAAAATGATTATATGATCGTTTTGAGCAAAGATAACAGTATG

TTATCAAAAGCCTTTGTCTATTACGTGGAACTTGTAAAGAAGAAATAAAATACCAATCAGAGC
Translation
MFSLPRGFEPPAPEDLGRQSSAELRERLRRQERLLRNE - UNI21491 - EKFICKLPDKGKKISDTVAKLKAAISEREEVRGRSELFHPVSVDCKLR

QKATTRADTDVDKAQSSDLMLDTSSLDPDCSSIDIKSSKSTSETQGPTHLTHRGNEETLEAGYTVNSSPAAHIRARAPSSEVKEHLPQHSVSSQEEEISS

SIDSLFITKLQKITIADQSEPSEENTSTENFPELQSETPKKPHYMKVLEMRARNPVPPPHKFKTNV VLPTQQSDSPSHCQRGQSPASSEEQRRRARQHL

DDITAARLLPLHHLPAQLLSIEESLALQREQKQNYE EMQAKLAAQKLAERLNIKMQSYNPEGESSGRYREVRDEADAQSSDEC

For any suggestions or comments, please send an email to unitrap@crg.es