Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032212 (Sltm)
Chromosomal location
Chr 9: 70390585 - 70440039 (+)
Description
SAFB-like, transcription modulator Gene [Source:MGI Symbol;Acc:MGI:1913910]
RefSeq_dna
NM_025690 
RefSeq_peptide
NP_079966.2 NP_080613.1 
UniGene
Mm.22379 
MGI
MGI:1913910 
Uniprot/SWISSPROT
Q8CH25 
Uniprot/SPTREMBL
Q9CS69 
Human Ortholog
ENSG00000137776 (SLTM)
Omim not available
UniTrap UNI114
Vector Insertion
Chr 9: 70390889 - 70391776
Public Clones GC0543 (tigem) DC0214 (sanger)
Private Clones OST421084 (lexicon) OST336187 (lexicon) OST324016 (lexicon) OST128960 (lexicon)
OST53958 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI107
Vector Insertion
Chr 9: 70391865 - 70406843
Public Clones GC0035 (tigem) YTA076 (baygenomics) YTA080 (baygenomics) YTA084 (baygenomics)
W007D08 (ggtc) A20008 (ggtc) IST12069B12 (tigm)
Private Clones OST435491 (lexicon) OST321987 (lexicon) OST30424 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22761
Vector Insertion
Chr 9: 70406909 - 70409582
Public Clones not available
Private Clones OST285314 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24542
Vector Insertion
Chr 9: 70410669 - 70419955
Public Clones not available
Private Clones OST216021 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12423
Vector Insertion
Chr 9: 70422433 - 70424528
Public Clones A029A08 (ggtc) A029E07 (ggtc) W015B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27851
Vector Insertion
Chr 9: 70427758 - 70427863
Public Clones not available
Private Clones OST45969 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12428
Vector Insertion
Chr 9: 70428138 - 70428589
Public Clones A016D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049263
Sequence
CGCCGCCCTGCAGCCCACTAGCTGCCTCGGCAGCGCGTTGCTTTCCCAAAATGGCTGCCGCTGCCGGGGCCGTGGTAGCCTCGGCCGCCTCTGGGCCGGC

GGAAGGGAAGAAGATCACGGAGCTGCGGGTTATCGACCTCAGGTCCGAGCTGAAGCGCCGCAACTTGGACATCAACGGGGTCAAGACGGTACTGGTCTCC

CGGCTGAAGCAG - UNI114 - GCTATTGAAGAGGAAGGAGGCGATCCAGATAATATTGAATTAACTGTTTCAACTGATACTCCAAACAAGAAACCAA

CCAAAGGCAAAG - UNI107 - GTAAAAAACAAGAAGCAGATGAGTTGAGTGGAGATGCTTCTGTGGAAGATGATTCTTTTGTCAAG - UNI22761

 - GACTGTGAATTGGAGAATCAAGAGACACATGACCAAGATGGAAATGAAGAGCTAAAGGACTTGGAAGAATTTGGTGAAAATGAAGAGGAAATTGTGC

ATTCCCAGGAGTTGCTTTCTACAGAAGAGAACAAGACAACTCAGGAATTTGTAGAGGCAGAAGCAATAGAAGATAGAGAAAAAGAGGACATCGAAAGTCA

G GAAACTGAAGCTCAAGAAGGTGAAGATGACACCTTTCTAACAGCTCAA - UNI24542 - GATGGTGAGGAAGAAGAAAATGAGAAAG ATATAGC

AGGTTCTGGTGATGGCACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCTCATGAAGAGATGGAAGCTAAT

GCGACTGGGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTGGATTTTGATGGTGATGACCTCCTAGAAACAG

GTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGTGCAGGACGCCATTGCACAGAGCCCGGAGAAGGAAGCCAAGGATTATGAGAT

GAACCCGAACCATAAAGATGGTAAGAAGGAAGACTCCGTGAAGGGTGAGCCTGTCGAGAAGGAAGCCAGAGAAAGTGCTAAGAAAGCAGAATCTGGAGAC

AAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACAGGGGCCTCTGGTCAAGCAAAGAG CTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCT

AAAGATGACAAAG - UNI12423 - GGAGCACAGGCAGTGCTGGTGGGAGCAGTGGAAGCTCAACCAAGAACATCTGGGTCAGTGGACTGTCTTCTAA

TACCAAAGCTGCTGATTTGAAGAACCTCTTTGGCAAATATGGAAAG GTTCTAAGTGCAAAGGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTA

TGGCATCGTAACCATGTCTTCAAGCACAGAAGTGTCCAGATGTGTTGCACATCTCCATCGCACAGAGCTGCATGGACAACTGATTTCTGTGGAGAAA - 

UNI27851 - GTCAAAGGTGATCCTTCTAAGAAAGAAATGAAGAAAGAAAATGATGAGAAGAGTAGCTCACGGAGCGCTGGTGATAAAAAGAACGCGAG

TGATCGGAGTGCCAA - UNI27851 - GACACAAGCATCTATTAAAAAAGAAGAGAAAAGGTCATCTGAGAAATCAGAAAAAAAAGAAAGCAAAGATA

CTAAGAAAATAGAGAAAGATGAGAAGAACGACGATGGTCCAAGTGGGCAGACTTCAGAGTCCCTGAAAAAGAGTGAAGAGAAGAAGCGGATAA - UNI1

2428 - GTTCAAAGAGTCCAGGACATATGGTGATACTAAACCAAACCAAGGGAGATCATTGTAGGCCGTCAAGAAGGGGCAGATATGAGAAA GGTCAT

GGAAGAAGCAAAGAAAAGGAGAGGGCTAGCCTAGATAAAAAAAGAGACAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAA

GATTGAGAGAACATTTAGTTCGTTTTGAAAGACTGAAACAAGCAGTGGAATTCAGAAG ACGAAAAGAGATTGCAGAAAGAGAGCGTCGAGAGCGTGAAC

GCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAGAGAGAGAGAATGGA

ACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAG GAGCGGCGCAGGGAAGCTGAAAGGATTGCTCGGGAGAGAGAGGAGCTCAGAAGGCAGCA

GCAGCAGCTTCGCTATGAACAAGAAAAAAGGAATTCTTTGAAACGCCCACGTGACGTAGACCATAG GCGAGATGACCCTTACTGGAGCGAGAATAAAAA

GTTATCTCTAGATACAGAGGCACGATTCGGCCATGGGTCTGACTATCGTCAACAGAGCAGGTTCCTTGACTTCAGTCACCGAGAACGGGCCAGGTTTCCT

GACACTGCATCTGTGCAGTCATCCTTTGAAAG ACGGGAACGGTTTGTTGGTCAAAGTGAAGGAAAGAAACCGAGACCAGCAGCCCGAAGAGAAGAGCCA

AGTTTTGAAAGGTACCCTAAAAACTTCAGTGATTCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAAACAGACAGACGAGAGGTCCGAG

GGGAGAGAGACGAGAGAAGAACAGTAATCCTTCATGACCGACCTGAGGTCGCTCACCCCAGACACCCTCGAGAGACTGTGCCCAATCCTTCTAGACCAAC

TTCCTGGAAAAGCGAAGCGAATATGTCCACAGAGAAACGGGAGTCACG AGTTGAAAGGCCAGAAAGATCTGGGAGAGAAGTCTCTGGACACACTGTGAG

GGGAGCGCCCCCCGGGAATCGGAGTAGTGCCTCAGGCTATGGAACCCGAGAGGGAGAGCGAGGAGTCATTGCTGACAGAGGAAGCGGAACACAG CACTA

CCCTGAAGAACGACATGTCGTGGAACGTCATGGACGGGACACAAGTGGACCAAGGAAAGAGTGGCATGGCCCACCCTCTCAGGGGCCTAGCTACCATGAC

ACAAGACGAATGGGTGATGGCCGAGCAGGAGCAGGCATGATAACCCAACACTCAAG CACTGCGTCCCCAGTGAACAGGATTGTACAGATGAGTGGTAAC

TCCTTGCCAAGAGGAAGCAGCTCGGGGTTTAAGCCGTTTAAGAGTGGACCTCCACGGCGATTTTAACGCAAGCTTCCTGCTGTGGCTTCAAGATAATTTA

TTGAGATCTCCTGTAAACGTTCCCTGACTGCTTACTAGGAGAACCTCTGACTGCTTGAGAGTTCTAGCTGACTGTTGTTTTTCTTTATAAAAAAATTTAA

CACGATTTCTTTTCTCAACTTTAGAGAAGATGTTTAAATAGTTCTGTTGAAACTTTTCATAGTTTTGTGTACCATTCAACCTTTTCTTGCAGCACTGAGA

CCCATTTGAAAGGATTGGCACAAGGCTGTTCTGTTTGGCACTGTGTGAACATGAGTGGTTTGCAGCTGAATGGTAGTGGTTTCATTTGCAGCGTAGCTCT

GTGGTGTCACCAGTGTTGGCTGCCTCCATTTTGAAGGCTATTTGAGCTTCAAAAGCCTGCTGTCTAATTTTTAGAGAATAAGATTGTTCCCTGCATTTCG

GAGTATTATGTAACCTATTTTTGCAGAAGGTACTGTTACATTAAGTGCATCTGTGTATCCTGGTTAAAAAAAAAATGTAATCTTTTTGGAAATAAACCTT

CATATTCTGTA
Translation
MAAAAGAVVASAASGPAEGKKITELRVIDLRSELKRRNLDINGVKTVLVSRLKQ - UNI114 - AIEEEGGDPDNIELTVSTDTPNKKPTKGKG - U

NI107 - GKKQEADELSGDASVEDDSFVK - UNI22761 - DCELENQETHDQDGNEELKDLEEFGENEEEIVHSQELLSTEENKTTQEFVEAEAIE

DREKEDIESQ ETEAQEGEDDTFLTAQ - UNI24542 - DGEEEENEKD DIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEANATGKEAEDDNIS

VTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDVQDAIAQSPEKEAKDYEMNPNHKDGKKEDSVKGEPVEKEARESAKKAESGDKEKDTLKKGPSS

TGASGQAKS SSSKESKDSKTSSKDDKG - UNI12423 - GSTGSAGGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGK VLSAKVVTNARSPGAKC

YGIVTMSSSTEVSRCVAHLHRTELHGQLISVEK - UNI27851 - VKGDPSKKEMKKENDEKSSSRSAGDKKNASDRSAK - UNI27851 - KTQA

SIKKEEKRSSEKSEKKESKDTKKIEKDEKNDDGPSGQTSESLKKSEEKKRIS - UNI12428 - SSKSPGHMVILNQTKGDHCRPSRRGRYEK GHGR

SKEKERASLDKKRDKDYRRKEILPFEKMKEQRLREHLVRFERLKQAVEFRR RRKEIAERERRERERIRIIREREERERLQRERERLEIERQKLERERME

RERLERERIRIEQ ERRREAERIAREREELRRQQQQLRYEQEKRNSLKRPRDVDHR RRDDPYWSENKKLSLDTEARFGHGSDYRQQSRFLDFSHRERAR

FPDTASVQSSFER RRERFVGQSEGKKPRPAARREEPSFERYPKNFSDSRRNEPPPPRNELRETDRREVRGERDERRTVILHDRPEVAHPRHPRETVPNP

SRPTSWKSEANMSTEKRESR RVERPERSGREVSGHTVRGAPPGNRSSASGYGTREGERGVIADRGSGTQ HYPEERHVVERHGRDTSGPRKEWHGPPSQ

GPSYHDTRRMGDGRAGAGMITQHSS STASPVNRIVQMSGNSLPRGSSSGFKPFKSGPPRRF
Transcript ENSMUST00000085386
Sequence
CGCGGCGCCGCTGGCCGCCCGGGGCCCGGGTTGGAAGTTGGTGCTGCCGCGGCCACCGCCTCCACCGCCGCTGCCTCCTCCTCCGCCGCCGCCGCCGCCC

TGCAGCCCACTAGCTGCCTCGGCAGCGCGTTGCTTTCCCAAAATGGCTGCCGCTGCCGGGGCCGTGGTAGCCTCGGCCGCCTCTGGGCCGGCGGAAGGGA

AGAAGATCACGGAGCTGCGGGTTATCGACCTCAGGTCCGAGCTGAAGCGCCGCAACTTGGACATCAACGGGGTCAAGACGGTACTGGTCTCCCGGCTGAA

GCAG - UNI107 - - UNI114 - GTAAAAAACAAGAAGCAGATGAGTTGAGTGGAGATGCTTCTGTGGAAGATGATTCTTTTGTCAAG - UNI22

761 - - UNI24542 - GATGGTGAGGAAGAAGAAAATGAGAAAG ATATAGCAGGTTCTGGTGATGGCACACAAGAAGTATCTAAACCTCTTCCTTC

AGAAGGGAGCCTAGCTGAGGCTGATCACACAGCTCATGAAGAGATGGAAGCTAATGCGACTGGGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATC

CAGGCTGAAGATGCCATCACTCTGGATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAG

ATGTGCAGGACGCCATTGCACAGAGCCCGGAGAAGGAAGCCAAGGATTATGAGATGAACCCGAACCATAAAGATGGTAAGAAGGAAGACTCCGTGAAGGG

TGAGCCTGTCGAGAAGGAAGCCAGAGAAAGTGCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACAGGGGCC

TCTGGTCAAGCAAAGAG CTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAG - UNI12423 - GGAGCACAGGCAGTGCTG

GTGGGAGCAGTGGAAGCTCAACCAAGAACATCTGGGTCAGTGGACTGTCTTCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGCAAATATGGAAA

G GTTCTAAGTGCAAAGGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATCGTAACCATGTCTTCAAGCACAGAAGTGTCCAGATGTGT

TGCACATCTCCATCGCACAGAGCTGCATGGACAACTGATTTCTGTGGAGAAA - UNI27851 - GTCAAAGGTGATCCTTCTAAGAAAGAAATGAAGA

AAGAAAATGATGAGAAGAGTAGCTCACGGAGCGCTGGTGATAAAAAGAACGCGAGTGATCGGAGTGCCAA - UNI27851 - GACACAAGCATCTATT

AAAAAAGAAGAGAAAAGGTCATCTGAGAAATCAGAAAAAAAAGAAAGCAAAGATACTAAGAAAATAGAGAAAGATGAGAAGAACGACGATGGTCCAAGTG

GGCAGACTTCAGAGTCCCTGAAAAAGAGTGAAGAGAAGAAGCGGATAA - UNI12428 - GTTCAAAGAGTCCAGGACATATGGTGATACTAAACCAA

ACCAAGGGAGATCATTGTAGGCCGTCAAGAAGGGGCAGATATGAGAAA GGTCATGGAAGAAGCAAAGAAAAGGAGAGGGCTAGCCTAGATAAAAAAAGA

GACAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGATTGAGAGAACATTTAGTTCGTTTTGAAAGACTGAAACAAGCAG

TGGAATTCAGAAG ACGAAAAGAGATTGCAGAAAGAGAGCGTCGAGAGCGTGAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGA

GAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAGAGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAG GAGC

GGCGCAGGGAAGCTGAAAGGATTGCTCGGGAGAGAGAGGAGCTCAGAAGGCAGCAGCAGCAGCTTCGCTATGAACAAGAAAAAAGGAATTCTTTGAAACG

CCCACGTGACGTAGACCATAG GCGAGATGACCCTTACTGGAGCGAGAATAAAAAGTTATCTCTAGATACAGAGGCACGATTCGGCCATGGGTCTGACTA

TCGTCAACAGAGCAGGTTCCTTGACTTCAGTCACCGAGAACGGGCCAGGTTTCCTGACACTGCATCTGTGCAGTCATCCTTTGAAAG ACGGGAACGGTT

TGTTGGTCAAAGTGAAGGAAAGAAACCGAGACCAGCAGCCCGAAGAGAAGAGCCAAGTTTTGAAAGGTACCCTAAAAACTTCAGTGATTCCAGAAGAAAT

GAGCCTCCACCACCAAGAAATGAACTTAGAGAAACAGACAGACGAGAGGTCCGAGGGGAGAGAGACGAGAGAAGAACAGTAATCCTTCATGACCGACCTG

AGGTCGCTCACCCCAGACACCCTCGAGAGACTGTGCCCAATCCTTCTAGACCAACTTCCTGGAAAAGCGAAGCGAATATGTCCACAGAGAAACGGGAGTC

ACG AGTTGAAAGGCCAGAAAGATCTGGGAGAGAAGTCTCTGGACACACTGTGAGGGGAGCGCCCCCCGGGAATCGGAGTAGTGCCTCAGGCTATGGAAC

CCGAGAGGGAGAGCGAGGAGTCATTGCTGACAGAGGAAGCGGAACACAG CACTACCCTGAAGAACGACATGTCGTGGAACGTCATGGACGGGACACAAG

TGGACCAAGGAAAGAGTGGCATGGCCCACCCTCTCAGGGGCCTAGCTACCATGACACAAGACGAATGGGTGATGGCCGAGCAGGAGCAGGCATGATAACC

CAACACTCAAG CACTGCGTCCCCAGTGAACAGGATTGTACAGATGAGTGGTAACTCCTTGCCAAGAGGAAGCAGCTCGGGGTTTAAGCCGTTTAAGAGT

GGACCTCCACGGCGATTTTAACGCAAGCTTCCTGCTGTGGCTTCAAGATAATTTATTGAGATCTCCTGTAAACGTTCCCTGACTGCTTACTAGGAGAACC

TCTGACTGCTTGAGAGTTCTAGCTGACTGTTGTTTTTCTTTATAAAAAAATTTAACACGATTTCTTTTCTCAACTTTAGAGAAGATGTTTAAATAGTTCT

GTTGAAACTTTTCATAGTTTTGTGTACCATTCAACCTTTTCTTGCAGCACTGAGACCCATTTGAAAGGATTGGCACAAGGCTGTTCTGTTTGGCACTGTG

TGAACATGAGTGGTTTGCAGCTGAATGGTAGTGGTTTCATTTGCAGCGTAGCTCTGTGGTGTCACCAGTGTTGGCTGCCTCCATTTTGAAGGCTATTTGA

GCTTCA
Translation
SAAAAALQPTSCLGSALLSQNGCRCRGRGSLGRLWAGGREEDHGAAGYRPQVRAEAPQLGHQRGQDGTGLPAEAG - UNI107 - - UNI114 - GK

KQEADELSGDASVEDDSFVK - UNI22761 - - UNI24542 - DGEEEENEKD DIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEANATGKEA

EDDNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDVQDAIAQSPEKEAKDYEMNPNHKDGKKEDSVKGEPVEKEARESAKKAESGDKEKDTL

KKGPSSTGASGQAKS SSSKESKDSKTSSKDDKG - UNI12423 - GSTGSAGGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGK VLSAKVVTNAR

SPGAKCYGIVTMSSSTEVSRCVAHLHRTELHGQLISVEK - UNI27851 - VKGDPS - UNI27851 -  - UNI12428 -         

For any suggestions or comments, please send an email to unitrap@crg.es