Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032217 (Rnf111)
Chromosomal location
Chr 9: 70273236 - 70351532 (-)
Description
ring finger 111 Gene [Source:MGI Symbol;Acc:MGI:1934919]
RefSeq_dna
NM_033604 
RefSeq_peptide
NP_291082.1 
UniGene
Mm.393030 
MGI
MGI:1934919 
Uniprot/SWISSPROT
Q99ML9 
Human Ortholog
ENSG00000157450 (RNF111)
Omim not available
UniTrap UNI5427
Vector Insertion
Chr 9: 70351162 - 70351265
Public Clones CSJ178 (baygenomics) P064F11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38519
Vector Insertion
Chr 9: 70350746 - 70351162
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10851
Vector Insertion
Chr 9: 70324476 - 70350746
Public Clones (sanger) Q007B01 (ggtc) P138D02 (ggtc) P105E12 (ggtc) H001A12 (ggtc)
E020E11 (ggtc) D144E02 (ggtc) D100F05 (ggtc) D049B02 (ggtc) D035G07 (ggtc)
D008D07 (ggtc) P145B11 (ggtc) P128G07 (ggtc) P104A08 (ggtc) E120G09 (ggtc)
D186E11 (ggtc) D133A10 (ggtc) D088C12 (ggtc) D044E08 (ggtc) D034F08 (ggtc)
D005E08 (ggtc) 3SE307H03 (ggtc) P138H06 (ggtc) P120D12 (ggtc) P093E03 (ggtc)
E064B07 (ggtc) D160D08 (ggtc) D106H03 (ggtc) D080H05 (ggtc) D035G08 (ggtc)
D027C09 (ggtc) P146A04 (ggtc) P137E03 (ggtc) E125G07 (ggtc) E019A11 (ggtc)
D137E06 (ggtc) D098A09 (ggtc) D047H08 (ggtc) D035F12 (ggtc) 5SE305E04 (ggtc)
P143C11 (ggtc) P127B07 (ggtc) E067G06 (ggtc) D161G02 (ggtc) D128B04 (ggtc)
D041F10 (ggtc) 5SE307G03 (ggtc) P027B12 (ggtc) D022G08 (ggtc) P105D11 (ggtc)
E121C09 (ggtc) E001G09 (ggtc) D133C09 (ggtc) D008C09 (ggtc) 5SE305E03 (ggtc)
D003E03 (ggtc) P100E07 (ggtc) E067F12 (ggtc) D123E11 (ggtc) D082F05 (ggtc)
3SE307G03 (ggtc) CMHD-GT_285F2-3 (cmhd) CMHD-GT_261D5-3 (cmhd) FHCRC-GT-S5-11C1 (fhcrc)
PST23319-NR (escells) PST19009-NR (escells) PST9088-NR (escells) PST24460-NR (escells)
PST22646-NR (escells) PST7535-NR (escells) PST6997-NR (escells) PST23182-NR (escells)
PST19532-NR (escells) PST8868-NR (escells) PSTVU01.J38 (vanderbilt) IST14567G7 (tigm)
IST13209H10 (tigm) IST11801F8 (tigm) IST11743D6 (tigm) IST14726D10 (tigm)
IST10786G11 (tigm) IST12295A3 (tigm) IST13087F3 (tigm) IST10979E5 (tigm)
IST11547E6 (tigm) IST14649B7 (tigm) IST14070D1 (tigm) IST14395B11 (tigm)
IST14407G11 (tigm) IST12126C1 (tigm) IST10263H9 (tigm) IST11574F4 (tigm)
IST11597H8 (tigm) IST14378G11 (tigm) IST14858H6 (tigm) IST11585G11 (tigm)
IST14139D9 (tigm) IST14306H8 (tigm) IST14551H6 (tigm) IST10090A10 (tigm)
IST14258F9 (tigm) IST14444C9 (tigm) IST13040H9 (tigm) IST14161B4 (tigm)
IST14965B2 (tigm) IST10928H3 (tigm) IST14532B2 (tigm)
Private Clones OST442344 (lexicon) OST432424 (lexicon) OST422396 (lexicon) OST410883 (lexicon)
OST347352 (lexicon) OST323010 (lexicon) OST309304 (lexicon) OST303441 (lexicon)
OST274413 (lexicon) OST260409 (lexicon) OST240615 (lexicon) OST234016 (lexicon)
OST222678 (lexicon) OST208116 (lexicon) OST207453 (lexicon) OST205119 (lexicon)
OST194687 (lexicon) OST191841 (lexicon) OST187888 (lexicon) OST179581 (lexicon)
OST172946 (lexicon) OST170760 (lexicon) OST167624 (lexicon) OST166042 (lexicon)
OST155760 (lexicon) OST136145 (lexicon) OST118642 (lexicon) OST109682 (lexicon)
OST107105 (lexicon) OST78481 (lexicon) OST77825 (lexicon) OST66201 (lexicon)
OST63931 (lexicon) OST60380 (lexicon) OST57509 (lexicon) OST34672 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22841
Vector Insertion
Chr 9: 70317289 - 70323582
Public Clones (sanger) IST11667A10 (tigm) IST14922A11 (tigm) IST11585A2 (tigm)
IST10918H10 (tigm) IST14971E5 (tigm) IST14632F7 (tigm)
Private Clones OST283435 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI43
Vector Insertion
Chr 9: 70305826 - 70306796
Public Clones GC0313 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21124
Vector Insertion
Chr 9: 70298349 - 70301307
Public Clones not available
Private Clones OST340606 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113595
Sequence
GCCGCGGCGGCCGGCCCGGGTCGGCGACAGGGGAATGACCGCGGGTCCCGGACGGCGCGGAGTGGCTCATTGTGTCCGGGCAAGAGTCCGCCCGCGGACA

CACCCACGGCCTCTTGGGAGGGG ATAATTGATCGGAGTCAGCAGTGGTGCGGTGGAAATATCGGTTTTTGTTCTGGAGAAATAGAG - UNI10851 -

 GCCTTCCCTGAAGTTTCCCATGTCTCAATGGACTCCTGAATTTAACGAGCTCTACACCCTAAAAGTGGCTATGAAGAGTGGGACTCCTGATGCGCCCAC

TACACAGGAGAGTCTGAAGGCGGTCCTTCTGCACCCACAGCCCCTAGGGGCCACCAAGAGCTTCCCTGCAGAAGTGGAGATGATTAATAGCAAAGTGGGG

AATGAATTCTCTCATCTGTGTGATGATTCTCAAAAACAAGAGAAGGACATGACTGGCAACCAGCAAGAACAAGAAAAAAGTGGTGTTGTGAGAAAAAAGC

GCAAAAGCCAGCAGGCTGGCCCCTCATATGTGCAGAACTGTGTCAAAGAAAATCAGGAAATCCTAGGGCGCAGACAACAGCTAGAGACACCGAGTGATGA

GGATAATGACTCTTCCTTAAGTGAGTGTCTGTCTTCTCCCTCATCTAGTCTCCATTTTGGGGGCTCTGATACAGTGACTTCAGATGAGGATAAAGAAGTC

TCGGTGAGACATACCCAGCCTGTTCTGAGTGCTAAAAGTAGAAGTCACAGTGCAAGGTCTCACAAGTGGCCTCGAACTGAGGCAGATCCTGTGCCAAGTT

TGTTAATGAAAAGACCTTGTTTTCATGGCAGTGCACTAAGGAGAGTCACATGCAGAAAGAGGCTGGTGAAGAGCAGCTCCTCGCAGAGGACACAGAAGCA

GAAGGAGAGGATGCTAGTGCAGAGGAAGAAGCGGGAGGCGCTAGCTCAGAGGAAGTATGCTCTTCTCTCCAGCTCCAGTAGCTCCAGTGAGAATGACCTC

AGCAGCGATTCCTCGTCCAGCTCCTCCACCGATGGAGAAGAGGACCTGTGTGCATCTGCCAGTGAGAACCCCAGCAACCCCGCTGCTCCCTCAG - UNI

22841 - GAAGTATTGATGAAGATGTTGTGGTGATAGAAGCCTCCTTCACTCCCCAGGTCACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGT

GAAGTGGAGATTGTTACAGTTGGAGAAAGCTATCG GTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAAGGTTCAAGTTCGCATACAGGA

CGGCCACAGGAGTCTCGAAACCGCAGTAGGATCTCTACTGTTATACAGCCCCTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACTGTTGATGAAGATG

 - UNI43 - AACCTACTATAGTACCAACCACTTCTGCTAGAATGGACTCACAAACTACTAGTGCTTCCATTAACAATTCAAATCCATCTACCTCTGAG

CAAGCCTCTGATACTACTTCAACTGTGGCCAGTAGCCAGCCTTCCACAGTGTCAGAGACTGAAGCTACTCTTACAAGCAATAGTGCAACTGGTTCTTCTG

TGGGCG ATGACGTGAGGAGAACTGCATCTAGTGCTGTCCCAGAAAGTGGTCCTCCTGCAATGCCAAGGCTACCTTCTTGCTGCCCCCAGCACTCACCAT

GTGGAGGGACATCACAGAGCCATCATGCATTAGCACACCCACACTCAAGTTGTTTTCAGCAGCATGGCCACCATTTTCAGCATCACCACCATCACCACCA

TACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTCAGTGACCCTGCTTGCCCAGTGGAAAGACCTCAAGTACAGGCGCCTTGTGGAGCAAATAGCAGC

TCTGGTTCCAGCTACCATGACCAG - UNI21124 - CAGGCATTGCCAGTCGATCTGAGCAACAGTGCTCTCAGGACTCATGGAAGTGGGGGTTTCCA

TGGTGCATCTGCTTTTGACCCCTGCTGCCCTGTCACATCTTCCCGGGCTGCAGTCTTTGGCCATCAGGCTGCTGCTGCCCCGACTCAGCCATTATCAATA

GATGGCTATGGCTCCAGCATGGTTGCCCAGCCCCAGCCCCAGCCCCCTCCACAGCCTTCTCTTTCGTCATGTCGGCACTACATGCCACCTCCGT ATGCT

TCCTTGACAAGACCACTGCACCATCAAGCCTCAGCTTGCCATCACTCTCATGGAAATGCCCCTCCCCAGACTCAGCCTCCCCCTCAAGTGGATTACGTGA

TTCCGCATCCTGTCCATGCTTTCCATTCTCAGATATCTTCTCATGCAGCATCTCACCCTGTGGCACCACCGCCGCCAACACATTTAGGCAGTACAGCGGC

ACCCATCCCTCAGCATCTTCCTCCTGCTCACCAGCCAATTTCACACCATATTCCAGCCCCAGCACCTTCAGCCCAGAGACTGCACCCTCATGAAGTGATG

CAGAGGATGGAAGTTCAGAGGAGGAGGATGATGCAGCATCCAAC GCGGGCACATGAACGGCCCCCGCCCCATCCACATAGGATGCACCCAAACTATGGC

CATGGGCATCATATTCATGTGCCTCAAACCATGTCTTCACATCCTCGCCAGGCTCCAGAGAGAACTGCCTG GGAACTGGGGATTGAAGCTGGAGTAACT

GCAGCTACCTACACACCTGGTGCTCTGCACCCTCACCTGGCCCATTACCACGCCCCGCCTCGACTTCATCACCTCCAGTTAGGAGCACTTCCTTTAATG 

GTTCCTGACATGGCAGGCTATCCTCACATCCGTTATATTTCTTCAGGATTGGATGGAGCATCATTCAGAGGTCCTTTTAGGGGCAATTTTGAG GAATTG

ATTCATCTGGAAGAAAGATTAGGAAATGTCAATCGTGGAGCCTCCCAGGGAACAATTGAAAGATGCACATATCCACATAAATATAAAAAG GTAACAACT

GATTGGTTCTCACAGAGGAAACTGCACTGCAAACAAGATGGGGAAGAAGGGACTGAGGAAGACACAGAGGAAAAATGTACTATCTGTTTGTCTATTTTAG

AGGAAGGTGAAGATGTGAG GCGCCTTCCATGTATGCACCTTTTCCACCAAGTGTGTGTTGATCAGTGGCTGATCACCAATAAGAAGTGCCCCATATGCA

GAGTGGACATCGAGGCCCAGCTGCCAAGTGAAAGTTGACATTGTGTTTCAGAACTCTTGGTGTCCCTCTCATTCCTATCCTTCCTGGTACTGCAGTCAAC

CAAAGATGGCATGACTTACCTGCGCAGATCTGGAAGCCTTGAACTCGGAGTGCTGACTCTGCTACATGGTACAGCTACCGCTAGACCTACAACTTATGTA

CACAGTTGATTTTGATGTATTTATAAAAGCTTTTTTTTTCCCTAGATTTGACATTACTTCCTGTATCATTTTACTGTATTTTTGCATGATTCCTTGTATT

GCATTTCTTTGCACATATTATGGGCTTGTGACCCTAAACTTGCAGGCAAGATTAGCTGCTTTAGTAAGTAGTATTTTGTGGTCTTTTTTTTGTTTTTTGG

GTTTTTTTGTTTTTGTTTTTGTTTTGTTTTTGTTTTTTGTTTTTTACATAGTACCTTGAAAATTATGAATTTTTTATCCATTACTAACCTTTAATTTAAT

CAATCATGTACTTTAGTTTAATGTATAAAGATTTTCTAGGAAATGATATTGTGTATTAAGACATTCCTTAATTAAATTAGGACAAAATGGCTGCTGTATA

TTTACAATATGGAATTCTGAGTTAAGTACCGCCCTTCATACTGGGAACAGAATGTATGTAACCCATGTCAATCAGATGCAGGTGGTACCCACACGACCAG

AGTGATCAATAGGAATTTTCTTGGTGTTCCTTTCTTCCAGCACAGTGCAAGATAGAGTTGCTGTTGATGCCATATGTTTAGACTGCTGTTCTGACCCTAT

TTATCTTTCTCTCTGCCATTTGGAACTTTATTCCCTAACCCAGGTTTTGCTGCTGTGAAACAGCGTTGATGAACACTAAATATTAATCTGAGATAGCTGG

ATTGTATATACTTGCAGATTTAAAAATATAGGGAAATTGAAAAAGACATGTAGAATTTTGTTAGGTCTTCTGCTAAGCACGAATAAGATATCTGCTTACA

TTAATTTTTATAAAGTCATTCAGTCAGAATTTAGGATTCAGTCATTGGCAGGTATCTATGCATTCGTAGAACTTCTAAGGGTCCCAGGATCACTTTTAAG

GGATTTTTTTTTTATAGTTTAAATAAAGTCAGCTGAATCTACATGTCTCTTGTTTTATTTCTCTCTAAACTTGAAAACAGTAAATCTGCAGATACTGTGA

GGCACAGATTATATTGTCAAGCTACTGTTGCTATGGTTATAGACACCCACTTCAGACATTACCAAGAGTCGATCACTGACTTAAAAATTTTAATTTCTAT

AGTTAAGATTTACAACATAATATAGAGTGAAAGTTAACATACTAACATTTCTCCTTTGGAGGAAGTTTTAATCCACTTCAGGATGCATATTAGCAAGATA

CTTTCATATACAGGATAGCCTAATTTTATTTGTTTAAATATGCTTAATATGCCCAAGATTGCAAATGCATCCAGTCAGTAATACCACTGTCTGTATGTGG

AAGACATGTTCCCATGGATCATATGTGAAGATGTCAATAAGCTTGCATTAAGCCACCTGCTTTGTAAGTGGATTGATTAATAAATAACTTATATTTCT
Translation
  - UNI10851 - MSQWTPEFNELYTLKVAMKSGTPDAPTTQESLKAVLLHPQPLGATKSFPAEVEMINSKVGNEFSHLCDDSQKQEKDMTGNQQEQE

KSGVVRKKRKSQQAGPSYVQNCVKENQEILGRRQQLETPSDEDNDSSLSECLSSPSSSLHFGGSDTVTSDEDKEVSVRHTQPVLSAKSRSHSARSHKWPR

TEADPVPSLLMKRPCFHGSALRRVTCRKRLVKSSSSQRTQKQKERMLVQRKKREALAQRKYALLSSSSSSSENDLSSDSSSSSSTDGEEDLCASASENPS

NPAAPSG - UNI22841 - GSIDEDVVVIEASFTPQVTANEEINVTSTDSEVEIVTVGESYR RSRSTLGHSRSHWSQGSSSHTGRPQESRNRSRIST

VIQPLRQNAAEVVDLTVDEDE - UNI43 - EPTIVPTTSARMDSQTTSASINNSNPSTSEQASDTTSTVASSQPSTVSETEATLTSNSATGSSVGD D

DVRRTASSAVPESGPPAMPRLPSCCPQHSPCGGTSQSHHALAHPHSSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVERPQVQAPCGANSSSGS

SYHDQ - UNI21124 - QALPVDLSNSALRTHGSGGFHGASAFDPCCPVTSSRAAVFGHQAAAAPTQPLSIDGYGSSMVAQPQPQPPPQPSLSSCRHY

MPPPY YASLTRPLHHQASACHHSHGNAPPQTQPPPQVDYVIPHPVHAFHSQISSHAASHPVAPPPPTHLGSTAAPIPQHLPPAHQPISHHIPAPAPSAQ

RLHPHEVMQRMEVQRRRMMQHPT TRAHERPPPHPHRMHPNYGHGHHIHVPQTMSSHPRQAPERTAW WELGIEAGVTAATYTPGALHPHLAHYHAPPRL

HHLQLGALPLM VPDMAGYPHIRYISSGLDGASFRGPFRGNFE ELIHLEERLGNVNRGASQGTIERCTYPHKYKK VTTDWFSQRKLHCKQDGEEGTEE

DTEEKCTICLSILEEGEDVR RRLPCMHLFHQVCVDQWLITNKKCPICRVDIEAQLPSES
Transcript ENSMUST00000034739
Sequence
CGACGGCGATGGTGGCGGGGCGCTGGTGCTGCGCGGCGTAAGGCACGCCGGCCGTTCAGGGTCGCGAGCGCGCGTGGGCCGCGATCGGGTGCTCGGAGCC

GGGTCCAGCCGAGCCAGGCTCAGCCTCACGCTCCGCGGCGGCGGTGTTGACAGACGCCCTCCTGAGGAGAGCCGCCCGGCCCGCCTCAGCCTCACCCGGC

CGAGCGCTGTTCCCCAGCCCCGCGCCAGCGAGTCCGGGACCTGGCCGCACGGGGCCTGCGGACTCGG - UNI5427 - ATAATTGATCGGAGTCAGCA

GTGGTGCGGTGGAAATATCGGTTTTTGTTCTGGAGAAATAGAG - UNI10851 - GCCTTCCCTGAAGTTTCCCATGTCTCAATGGACTCCTGAATTT

AACGAGCTCTACACCCTAAAAGTGGCTATGAAGAGTGGGACTCCTGATGCGCCCACTACACAGGAGAGTCTGAAGGCGGTCCTTCTGCACCCACAGCCCC

TAGGGGCCACCAAGAGCTTCCCTGCAGAAGTGGAGATGATTAATAGCAAAGTGGGGAATGAATTCTCTCATCTGTGTGATGATTCTCAAAAACAAGAGAA

GGACATGACTGGCAACCAGCAAGAACAAGAAAAAAGTGGTGTTGTGAGAAAAAAGCGCAAAAGCCAGCAGGCTGGCCCCTCATATGTGCAGAACTGTGTC

AAAGAAAATCAGGAAATCCTAGGGCGCAGACAACAGCTAGAGACACCGAGTGATGAGGATAATGACTCTTCCTTAAGTGAGTGTCTGTCTTCTCCCTCAT

CTAGTCTCCATTTTGGGGGCTCTGATACAGTGACTTCAGATGAGGATAAAGAAGTCTCGGTGAGACATACCCAGCCTGTTCTGAGTGCTAAAAGTAGAAG

TCACAGTGCAAGGTCTCACAAGTGGCCTCGAACTGAGGCAGATCCTGTGCCAAGTTTGTTAATGAAAAGACCTTGTTTTCATGGCAGTGCACTAAGGAGA

GTCACATGCAGAAAGAGGCTGGTGAAGAGCAGCTCCTCGCAGAGGACACAGAAGCAGAAGGAGAGGATGCTAGTGCAGAGGAAGAAGCGGGAGGCGCTAG

CTCAGAGGAAGTATGCTCTTCTCTCCAGCTCCAGTAGCTCCAGTGAGAATGACCTCAGCAGCGATTCCTCGTCCAGCTCCTCCACCGATGGAGAAGAGGA

CCTGTGTGCATCTGCCAGTGAGAACCCCAGCAACCCCGCTGCTCCCTCAG - UNI22841 - GAAGTATTGATGAAGATGTTGTGGTGATAGAAGCCT

CCTTCACTCCCCAGGTCACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTTACAGTTGGAGAAAGCTATCG GTCTCGTT

CAACCCTTGGACACTCCAGATCTCATTGGAGCCAAGGTTCAAGTTCGCATACAGGACGGCCACAGGAGTCTCGAAACCGCAGTAGGATCTCTACTGTTAT

ACAGCCCCTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACTGTTGATGAAGATG - UNI43 - AACCTACTATAGTACCAACCACTTCTGCTAGAA

TGGACTCACAAACTACTAGTGCTTCCATTAACAATTCAAATCCATCTACCTCTGAGCAAGCCTCTGATACTACTTCAACTGTGGCCAGTAGCCAGCCTTC

CACAGTGTCAGAGACTGAAGCTACTCTTACAAGCAATAGTGCAACTGGTTCTTCTGTGGGCG ATGACGTGAGGAGAACTGCATCTAGTGCTGTCCCAGA

AAGTGGTCCTCCTGCAATGCCAAGGCTACCTTCTTGCTGCCCCCAGCACTCACCATGTGGAGGGACATCACAGAGCCATCATGCATTAGCACACCCACAC

TCAAGTTGTTTTCAGCAGCATGGCCACCATTTTCAGCATCACCACCATCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTCAGTGACC

CTGCTTGCCCAGTGGAAAGACCTCAAGTACAGGCGCCTTGTGGAGCAAATAGCAGCTCTGGTTCCAGCTACCATGACCAG - UNI21124 - CAGGCA

TTGCCAGTCGATCTGAGCAACAGTGCTCTCAGGACTCATGGAAGTGGGGGTTTCCATGGTGCATCTGCTTTTGACCCCTGCTGCCCTGTCACATCTTCCC

GGGCTGCAGTCTTTGGCCATCAGGCTGCTGCTGCCCCGACTCAGCCATTATCAATAGATGGCTATGGCTCCAGCATGGTTGCCCAGCCCCAGCCCCAGCC

CCCTCCACAGCCTTCTCTTTCGTCATGTCGGCACTACATGCCACCTCCGT ATGCTTCCTTGACAAGACCACTGCACCATCAAGCCTCAGCTTGCCATCA

CTCTCATGGAAATGCCCCTCCCCAGACTCAGCCTCCCCCTCAAGTGGATTACGTGATTCCGCATCCTGTCCATGCTTTCCATTCTCAGATATCTTCTCAT

GCAGCATCTCACCCTGTGGCACCACCGCCGCCAACACATTTAGGCAGTACAGCGGCACCCATCCCTCAGCATCTTCCTCCTGCTCACCAGCCAATTTCAC

ACCATATTCCAGCCCCAGCACCTTCAGCCCAGAGACTGCACCCTCATGAAGTGATGCAGAGGATGGAAGTTCAGAGGAGGAGGATGATGCAGCATCCAAC

 GCGGGCACATGAACGGCCCCCGCCCCATCCACATAGGATGCACCCAAACTATGGCCATGGGCATCATATTCATGTGCCTCAAACCATGTCTTCACATCC

TCGCCAGGCTCCAGAGAGAACTGCCTG GGAACTGGGGATTGAAGCTGGAGTAACTGCAGCTACCTACACACCTGGTGCTCTGCACCCTCACCTGGCCCA

TTACCACGCCCCGCCTCGACTTCATCACCTCCAGTTAGGAGCACTTCCTTTAATG GTTCCTGACATGGCAGGCTATCCTCACATCCGTTATATTTCTTC

AGGATTGGATGGAGCATCATTCAGAGGTCCTTTTAGGGGCAATTTTGAG GAATTGATTCATCTGGAAGAAAGATTAGGAAATGTCAATCGTGGAGCCTC

CCAGGGAACAATTGAAAGATGCACATATCCACATAAATATAAAAAG GTAACAACTGATTGGTTCTCACAGAGGAAACTGCACTGCAAACAAGATGGGGA

AGAAGGGACTGAGGAAGACACAGAGGAAAAATGTACTATCTGTTTGTCTATTTTAGAGGAAGGTGAAGATGTGAG GCGCCTTCCATGTATGCACCTTTT

CCACCAAGTGTGTGTTGATCAGTGGCTGATCACCAATAAGAAGTGCCCCATATGCAGAGTGGACATCGAGGCCCAGCTGCCAAGTGAAAGTTGACATTGT

GTTTCAGAACTCTTGGTGTCCCTCTCATTCCTATCCTTCCTGGTACTGCAGTCAACCAAAGATGGCATGACTTACCTGCGCAGATCTGGAAGCCTTGAAC

TCGGAGTGCTGACTCTGCTACATGGTACAGCTACCGCTAGACCTACAACTTATGTACACAGTTGATTTTGATGTATTTATAAAAGCTTTTTTTTTCCCTA

GATTTGACATTACTTCCTGTATCATTTTACTGTATTTTTGCATGATTCCTTGTATTGCATTTCTTTGCACATATTATGGGCTTGTGACCCTAAACTTGCA

GGCAAGATTAGCTGCTTTAGTAAGTAGTATTTTGTGGTCTTTTTTTTGTTTTTTGGGTTTTTTTGTTTTTGTTTTTGTTTTGTTTTTGTTTTTTGTTTTT

TACATAGTACCTTGAAAATTATGAATTTTTTATCCATTACTAACCTTTAATTTAATCAATCATGTACTTTAGTTTAATGTATAAAGATTTTCTAGGAAAT

GATATTGTGTATTAAGACATTCCTTAATTAAATTAGGACAAAATGGCTGCTGTATATTTACAATATGGAATTCTGAGTTAAGTACCGCCCTTCATACTGG

GAACAGAATGTATGTAACCCATGTCAATCAGATGCAGGTGGTACCCACACGACCAGAGTGATCAATAGGAATTTTCTTGGTGTTCCTTTCTTCCAGCACA

GTGCAAGATAGAGTTGCTGTTGATGCCATATGTTTAGACTGCTGTTCTGACCCTATTTATCTTTCTCTCTGCCATTTGGAACTTTATTCCCTAACCCAGG

TTTTGCTGCTGTGAAACAGCGTTGATGAACACTAAATATTAATCTGAGATAGCTGGATTGTATATACTTGCAGATTTAAAAATATAGGGAAATTGAAAAA

GACATGTAGAATTTTGTTAGGTCTTCTGCTAAGCACGAATAAGATATCTGCTTACATTAATTTTTATAAAGTCATTCAGTCAGAATTTAGGATTCAGTCA

TTGGCAGGTATCTATGCATTCGTAGAACTTCTAAGGGTCCCAGGATCACTTTTAAGGGATTTTTTTTTTATAGTTTAAATAAAGTCAGCTGAATCTACAT

GTCTCTTGTTTTATTTCTCTCTAAACTTGAAAACAGTAAATCTGCAGATACTGTGAGGCACAGATTATATTGTCAAGCTACTGTTGCTATGGTTATAGAC

ACCCACTTCAGACATTACCAAGAGTCGATCACTGACTTAAAAATTTTAATTTCTATAGTTAAGATTTACAACATAATATAGAGTGAAAGTTAACATACTA

ACATTTCTCCTTTGGAGGAAGTTTTAATCCACTTCAGGATGCATATTAGCAAGATACTTTCATATACAGGATAGCCTAATTTTATTTGTTTAAATATGCT

TAATATGCCCAAGATTGCAAATGCATCCAGTCAGTAATACCACTGTCTGTATGTGGAAGACATGTTCCCATGGATCATATGTGAAGATGTCAATAAGCTT

GCATTAAGCCACCTGCTTTGTAAGTGGATTGATTAATAAATAACTTATATTTCTA
Translation
 - UNI5427 -  - UNI10851 - MSQWTPEFNELYTLKVAMKSGTPDAPTTQESLKAVLLHPQPLGATKSFPAEVEMINSKVGNEFSHLCDDSQKQ

EKDMTGNQQEQEKSGVVRKKRKSQQAGPSYVQNCVKENQEILGRRQQLETPSDEDNDSSLSECLSSPSSSLHFGGSDTVTSDEDKEVSVRHTQPVLSAKS

RSHSARSHKWPRTEADPVPSLLMKRPCFHGSALRRVTCRKRLVKSSSSQRTQKQKERMLVQRKKREALAQRKYALLSSSSSSSENDLSSDSSSSSSTDGE

EDLCASASENPSNPAAPSG - UNI22841 - GSIDEDVVVIEASFTPQVTANEEINVTSTDSEVEIVTVGESYR RSRSTLGHSRSHWSQGSSSHTGR

PQESRNRSRISTVIQPLRQNAAEVVDLTVDEDE - UNI43 - EPTIVPTTSARMDSQTTSASINNSNPSTSEQASDTTSTVASSQPSTVSETEATLTS

NSATGSSVGD DDVRRTASSAVPESGPPAMPRLPSCCPQHSPCGGTSQSHHALAHPHSSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVERPQV

QAPCGANSSSGSSYHDQ - UNI21124 - QALPVDLSNSALRTHGSGGFHGASAFDPCCPVTSSRAAVFGHQAAAAPTQPLSIDGYGSSMVAQPQPQP

PPQPSLSSCRHYMPPPY YASLTRPLHHQASACHHSHGNAPPQTQPPPQVDYVIPHPVHAFHSQISSHAASHPVAPPPPTHLGSTAAPIPQHLPPAHQPI

SHHIPAPAPSAQRLHPHEVMQRMEVQRRRMMQHPT TRAHERPPPHPHRMHPNYGHGHHIHVPQTMSSHPRQAPERTAW WELGIEAGVTAATYTPGALH

PHLAHYHAPPRLHHLQLGALPLM VPDMAGYPHIRYISSGLDGASFRGPFRGNFE ELIHLEERLGNVNRGASQGTIERCTYPHKYKK VTTDWFSQRKL

HCKQDGEEGTEEDTEEKCTICLSILEEGEDVR RRLPCMHLFHQVCVDQWLITNKKCPICRVDIEAQLPSES

For any suggestions or comments, please send an email to unitrap@crg.es