Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032218 (Ccnb2)
Chromosomal location
Chr 9: 70255499 - 70269354 (-)
Description
cyclin B2 Gene [Source:MGI Symbol;Acc:MGI:88311]
RefSeq_dna
NM_007630 
RefSeq_peptide
NP_031656.2 
MGI
MGI:88311 
Uniprot/SWISSPROT
P30276 
Uniprot/SPTREMBL
Q922E9 Q9CYU2 
Human Ortholog
ENSG00000157456 (CCNB2)
Omim not available
UniTrap UNI4823
Vector Insertion
Chr 9: 70266937 - 70269223
Public Clones AM0784 (sanger) (sanger)
Private Clones OST300161 (lexicon) OST163968 (lexicon) OST163948 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23097
Vector Insertion
Chr 9: 70266715 - 70266807
Public Clones CMHD-GT_487G10-3 (cmhd)
Private Clones OST276449 (lexicon) OST163956 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI795
Vector Insertion
Chr 9: 70261080 - 70266600
Public Clones CH0294 (sanger) AF0306 (sanger) RRT627 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034742
Sequence
GAATCGCGGACCGGGCGGTGGACGCGGAGCGGCGGGGCCCTGACCCTCCCAACGGTGTCGCAGACCGGAGTGGCTGTGCCTCGTCCGCACTTGCCAGGGC

GGCCCTCATGGCGCTGCTCCGACGCCCGACG - UNI4823 - GTGTCCAGTGATTTGAAGAATATTGACACAGAAGTTATTCCTAAAGCCAAGAGCCA

TGTGACTATCCGGCGGGCAGTTTTAGAAGAAATTGGAAATAAAGTTAGAAACAGAACCACTCAGGTGGCGAAG - UNI23097 - AAACCTCAGAACA

CCAAAGTACCAGCTCTGCCCACCAAAGTGACAAATGTCAACAAGCAGCCGAAACCCACAGCCTCTGTGAAACCAGTGCAGATGGAGGCGCTAGCTCCCAA

G - UNI795 - GATCGTCCTCCCGCCCCTGAGGATGTCTCCATGAAGGAAGAGAGCCTCTGCCAAGCTTTCTCTGATGCTCTGCTCTGCAAGATCGAG

GACATAGATAACGAGGACAGGGAGAACCCTCAGCTCTGCAGTGACTACGTGAAGGACATCTACCAGTACCTCAGGCAGCTTGAG GTTTTACAGTCCATT

AATCCACACTTCTTAGATGGAAGAGATATAAATGGACGTATGCGTGCCATCCTGGTGGACTGGCTGGTCCAAGTCCATTCCAAGTTTCGGCTTCTGCAGG

AAACTCTGTACATGTGCATTGCCATCATGGACCGGTTCCTGCAG GCTCAGCTGGTCTGCCGGAAGAAACTGCAGCTGGTCGGGATCACAGCTCTGCTCC

TGGCTTCCAAATATGAGGAGATGTTTTCTCCAAATATCGAAGACTTTGTTTATATCACAGATAATGCTTACACCAGTTCCCAAATCCGAGAAATGGAGAC

TCTGATTTTGAAAGAGTTGAAATTTGAGTTGGGCCGACCTTTGCCACTTCACTTCTTAAGGCGAGCCTCAAAAGCCGGAGAG GTGGATGTTGAACAGCA

CACTTTAGCCAAGTACCTGATGGAGCTGACGCTCGTCGACTATGACATGGTGCACTACCATCCTTCTCAGGTGGCAGCCGCTGCCTCTTGCCTGTCTCAG

AAGGTGCTGGGCCAAGGAAAATGG AATTTGAAGCAGCAGTATTACACAGGCTACATGGAGAGTGAAGTCCTGGAAGTCATGCAGCACATGGCCAAGAAC

GTTGTGAAAGTCAATGACAACCGTACCAAGTTCATC GCTGTCAAGAACAAGTATGCCAGCAGCAGACTCCTGAAGATCAGCACGATCCCTCAGCTGAAC

TCCAAAATCATCAAAGACCTGGCCTCCCCTCTGCTGGGCAGCCCCTAGACACTGGACTGCCATCCTGCGCTTCTCAGATCCTGTATGTATTTTATTCTAG

TTTACATCACAAACCTCTTCTCAAACTCATTTTCTAATTGTGTATTGATGAAAAATAAAGCTATTGATTTTCTTATACTATCCTGTGTATGTTTGTATAC

TCTACACTGAAGAAATGTAGAATGGCCTACAATAACTCTGCTCTGTATTGAAGGAAAATAAAGCTATTGATCTAC
Translation
MALLRRPT - UNI4823 - VSSDLKNIDTEVIPKAKSHVTIRRAVLEEIGNKVRNRTTQVAK - UNI23097 - KPQNTKVPALPTKVTNVNKQPK

PTASVKPVQMEALAPK - UNI795 - DRPPAPEDVSMKEESLCQAFSDALLCKIEDIDNEDRENPQLCSDYVKDIYQYLRQLE VLQSINPHFLDGRD

INGRMRAILVDWLVQVHSKFRLLQETLYMCIAIMDRFLQ AQLVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKF

ELGRPLPLHFLRRASKAGE VDVEQHTLAKYLMELTLVDYDMVHYHPSQVAAAASCLSQKVLGQGKW NLKQQYYTGYMESEVLEVMQHMAKNVVKVNDN

RTKFI AVKNKYASSRLLKISTIPQLNSKIIKDLASPLLGSP

For any suggestions or comments, please send an email to unitrap@crg.es