Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032220 (Myo1e)
Chromosomal location
Chr 9: 70055157 - 70247874 (+)
Description
myosin IE Gene [Source:MGI Symbol;Acc:MGI:106621]
RefSeq_dna
NM_181072 
RefSeq_peptide
NP_851417.2 
UniGene
Mm.249311 Mm.465834 
MGI
MGI:106621 
Uniprot/SPTREMBL
Q3TLJ4 Q80X36 Q8C123 Q91ZI4 
Human Ortholog
ENSG00000157483 (MYO1E)
Omim not available
UniTrap UNI3110
Vector Insertion
Chr 9: 70055511 - 70134718
Public Clones CH0703 (sanger) (sanger) AN0665 (sanger) XK022 (baygenomics) RRR793 (baygenomics)
3SE288F09 (ggtc) 3SE187E03 (ggtc) 5SD094C12 (ggtc) 5SE223C10 (ggtc)
5SE288F09 (ggtc) 5SE187E03 (ggtc) FHCRC-GT-S1-7G1 (fhcrc) Ayu21-KBW120 (egtc)
IST11907C5 (tigm) IST14813D4 (tigm) IST14781D3 (tigm) IST12261E6 (tigm)
Private Clones OST356184 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13688
Vector Insertion
Chr 9: 70134863 - 70145073
Public Clones CMHD-GT_269D10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1491
Vector Insertion
Chr 9: 70145164 - 70149499
Public Clones CD0212 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2567
Vector Insertion
Chr 9: 70194576 - 70201066
Public Clones XS0247 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4098
Vector Insertion
Chr 9: 70210175 - 70215422
Public Clones AN0742 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5033
Vector Insertion
Chr 9: 70226618 - 70231610
Public Clones YTC487 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15419
Vector Insertion
Chr 9: 70243753 - 70246528
Public Clones PST7321-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034745
Sequence
AGCCTGAGCCAGAGAAGAGTTCGGATTAAGTGTTAAGAGAAAGCGGGTCCAGGCAAAGCAGTTGGACAAGCAATCCCGCAGAGCGCATCAGGGTGCATCT

CTAGACAGTTGGGGATCGCCAGGTCTGAGTGTGCACCGGGTCTGCTAAGTTTTGCCTTCACCTAGCGTTTCGGATCCCGCCTGGATGGAGTCCCTCTTGG

ATTTCCATTGGCTCCTGTGAGTGCTTGGGTGTCGGGAGCTTGTTTTTTGGCGAAGGGAACCAACTTTTGAAGTTCGCCCAGGAGACCGCGTTCCAGCCTC

AGTGCCTAGGCAGCGGGACCCGGCGGAGGCGCGACCGCGGCGGGAGTCACCATG - UNI3110 - GGCAGCAAAGGCGCCTACCGGTACCATTGGCAG

AGCCACAATGTCAAGCACAGTGGTGTGGACGACATGGTTCTACTGTCCAAGATCACAGAGAGCTCCATTGTAGAGAACCTGAAGAAGAGATACATGGACG

ACTATATTTTT - UNI13688 - ACATATATAGGGTCTGTATTAATCTCTGTCAACCCATTCAAGCAAATGCCATATTTTGGAGAAAAAGAAGTCGAA

ATGTACCAAGGAGCG - UNI1491 - GCACAGTATGAGAACCCGCCTCATATCTATGCCCTTGCTGATAGTATGTACAGAAACATGATCATCGACAGA

GAGAACCAGTGTGTCATCATCAG CGGTGAAAGTGGTGCTGGAAAGACAGTGGCTGCCAAGTACATTATGAGCTATGTCTCCAGAGTGTCTGGAGGAGGC

CCCAAGGTCCAG CATGTGAAGGACATCATCCTTCAATCCAACCCGCTCCTGGAGGCCTTCGGAAACGCCAAGACAGTGCGCAACAACAACTCCAGCCGA

TTT GGAAAATACTTTGAAATCCAGTTCAGTCCAGGTGGGGAACCAGATGGTGGCAAGATCTCCAACTTCCTTCTGGAAAAGTCCAGAGTGGTGATGCGG

AACCCGGGGGAACGGAGCTTCCACATATTCTACCAG CTCATTGAGGGTGCCTCTCCAGAGCAGAAGCAAAGCCTTGGCATCACCAGCATGGACTACTAT

TACTACCTGAGCCTCTCGGGGTCCTACAAGGTGGATGACATTGATGACAAGCGGGATTTCCAGGAAACCCTG CACGCCATGAATGTGATTGGAATCTTC

TCGGAAGAGCAGACTCTCGTGTTGCAGATTGTGGCTGGAATTCTCCACTTGGGAAACATCAGCTTCAAAGAAGTGGGCAACTATGCCGCCGTGGAGAGTG

AAGAAT TTTTGGCTTTTCCTGCGTATCTGCTGGGTATAAACCAAGACCGGTTAAAAGAGAAGCTAACGAGCCGCCAGATGGACAGTAAGTGGGGAGGAA

AGTCAGAGTCCATCCATGTGACCCTCAACGTGGAGCAGGCCTGCTACACCAGGGACGCGCTCGCCAAGGCCCTGCACGCACGAGTCTTTGATTTCTTGGT

AGAT TCTATCAATAAAGCCATGGAGAAGGACCACGAGGAGTACAACATTGGAGTCCTGGACATCTATGGCTTTGAAATATTTCAG AAAAATGGCTTTG

AGCAGTTCTGCATCAATTTCGTTAACGAAAAATTACAGCAGATTTTTATTGAGCTGACGCTAAAAGCAGAGCAG GAAGAATACGTTCAGGAGGGAATAA

GATGGACACCCATTGAATATTTCAATAATAAAATCGTGTGTGACCTCATAGAGAGCAAAGTC AACCCTCCTGGGATTATGAGCATCCTGGATGACGTGT

GCGCCACCATGCATGCTGTGGGTGAGGGGGCTGACCAGACTCTGCTACAGAAGCTCCAGATGCAGATCGGGAGCCATGAGCACTTCAACAGCTGGAACCA

AGGCTTCATCATTCACCACTACGCTGGGAAG GTTTCCTATGACATGGACGGCTTCTGCGAAAGGAACCGGGATGTGCTTTTCATGGACCTGATTGAACT

CATGCAGAGCAGTGAGCT GCCTTTTATAAAGTCTTTATTTCCTGAAAACCTGCAAGCTGACAAGAAAGGGCGCCCAACGACCGCAGGAAGCAAAATAAA

G - UNI2567 - AAACAAGCCAACGACCTGGTGAGCACCCTGATGAAATGCACACCCCACTACATTCGCTGCATAAAACCAAACGAAACCAAGAAGCC

TAAAGACTGGGAGGAGAGCAG AGTGAAGCATCAAGTGGAGTACCTGGGTCTCAAAGAAAACATCCGAGTGAGAAGAGCTGGTTATGCTTATCGGCGTGT

CTTCCAGAAGTTTCTACAGAG GTATGCCATTCTGACCAAAGCTACCTGGCCTGTGTGGAGAGGAGATGAGAAACAAGGTGTCCTCCATCTACTGCAGTC

TGTCAACATGGACAGCGACCAGTTCCAGCTTGGGAGAAGTAAAGTGTTCATCAAAGCCCCAGAGTCT - UNI4098 - CTGTTTCTTCTAGAAGAGAT

GAGAGAGAGAAAGTACGATGGTTACGCACGTGTGATACAGAAAACATGGAGGAAGTTCGTGGCCCGCAAGAAATATGTTCAAATGAGAGAAGAAG CCTC

AGACCTGCTGTTGAACAAGAAGGAGAGGAGGAGAAACAGCATCAACCGAAACTTCATCGGGGACTACATCGGGATGGAGGAGCGCCCGGAACTGCAGCAG

TTTGTAGGCAAGAGGGAGAAGATTGACTTTGCTGACACAGTCACCAAGTACGACAGGAGGTTCAAG GGTGTCAAGCGAGACCTGCTGCTAACCCCCAAG

TGCTTGTACTTAATTGGAAGGGAGAAGGTGAAGCAAGGCCCAGACAAAGGTGTTGTGAAGGAAGTCCTGAAGCGGAGGATCGAGGTGGAAAGGATCCTGT

CCGTGTCCCTCAG TACCATGCAGGATGACATCTTCATTCTCCACGAGCAAGAATATGACAGTTTGCTGGAGTCCGTCTTTAAAACGGAGTTCCTGAGCC

TCTTAGCAAAGCGATACGAGGAAAAAACCCAGAAGCAACTACCTCTGAAATTCAGCAATAC CCTTGAACTGAAGTTGAAAAAGGAGAACTGGGGTCCCT

GGAGTGCAGGGGGCTCCCGGCAAGTGCAGTTCCACCAAGGCTTCGGTGACCTGGCTATCCTCAAGCCCAGCAACAAAGTGCTGCAGGTCAGCATCGGACC

CGGGCTGCCCAAGAACTCCC GTCCTACCAGAAGAAACACCGTCACCAGCAGAGGGTATCCAGGTGGAACTAAGAACAATTACCCGATGAGAGCTGCCCC

TGCTCCCCCAG - UNI5033 - GATGCCATCAAAACGGAGTCATACGAAACCAGTTTGTGCCTCCTCCCCATGCCTTTGGAAACCAGAGGTCCAATCA

GAAAAGCCTGTACACCTCTATGGCCCGCCCACCCTTGCCAAGGCAACAGTCCACCGGCTCGGATCGATTGTCTCAGACGCCAGAGAGCCTGGATTTCCTC

AAGGTCCCGGACCAGGGTGTTGCTGG AGTCCGAAGACAAACGAGCAGCCGGCCTCCCCCAGCAGGGGGCAGACCAAAGCCTCAACCCAAGCCTAAGCCT

CAGGTGCCACAGTGCAAGGCCTTGTATGCCTATGATGCTCAGGACACGGACGAACTCAGCTTCAACGCCAACGATATTATTGATATTATTAAAGAAG - 

UNI15419 - ACCCTTCTGGCTGGTGGACGGGTAGACTACGAGGCAAGCAGGGCCTGTTTCCTAACAACTACGTCACCAAGATCTGAGGCGCTCGGAAA

CTGACACGTGGGCAGAGGAGCTCCAGGCGTGGACCGGGGAGGGGACTTTTGGGGACTCCTCTTCTGATCGACAGTGAGCAACTGCTACACCAAGGCCTGA

AGCTATTCTGACACCTTCCCCCATGGAAGACACAGAAAAGCTTGGGTTAGGGACAAGGACAAGTTATGGGTCACTCCACAAATGATCCTAAAAGGTAGTC

TAGTTCCCAGGAGCGCAAAAAACACCACCCACTAAGATTTATTTATTGTATTTAAATCTGGTGTAAGTAGCGGGGACTGCTTGGTGTCTATCCCACAGCC

TCCTGCCCACTCACCAGGTCCAGGGGACAGCAGGCGGTGACTCGATGACAAGTGCCTTTAGTTGAAGAGCACATCTCACTCATTCCTCTCTCAGTACCTG

ATACATTCCTCTGTGCTAACCCCCCCTTGGGGAGGACCCACCCTCTGGAGGCTGGACTTGGGGCGAACAGGCACTCACCTGTCACTGCCAAGGGCGGGCA

GGCCATCCTTCCGAGCCCATGGGAGCCGGGACCACTAAGACTGCTGGTGGGAAGAAGTTGGGTGCTGGGCTGATGGTCTTGCTTTCTCTTGGTCTTCGCT

TGTAATGTGGCTGGCCCATGTTGGTTTTATGTTTAATGCTGTGCTTATAATAAGAAAGAGCCCCCCCAAGCTGTACATTTATAAAAAGTGATCATATACT

GTATATAGAAAAATCTAGAAGCACATATGAATGCAGCAGGTAGTATTCCACTGTACCCATTCATGAAGGTAGGTTTTATTACAGGACTCGCACCAGGTAC

TTACAGACGCGCCCTCTCCTCTTTGCCTAGAGAAACAGTCACTGCATTCCCGCACAGTCCCTCAGACCCCCTTACCCTCTCCCTGTAGGAAATTCTCCTG

TGACCCCTCTGCCGTCCTCCCTTACTTCCTAAATAAATGTAACGGAGTCAGTGCAATGCCTTGTTTCTTCATGACATTTATTGTGGGTTATAATTTTCTC

CTAAAAACAAAACCAGTGGTATGGTCATACCCACCATTGTTTCCCCACTTTCCATGACCGTCACAAACATCTGGGATGAGCACCTTGTGAGCAGGAAAAG

TTATGCTTTAAGAAATTTCTGGCCAGGCGTGGTGGCATACACCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGTGGATTTCTGAGTTCGAGGCCAGCC

TGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGAAACCCTGTCTCGA
Translation
M - UNI3110 - GSKGAYRYHWQSHNVKHSGVDDMVLLSKITESSIVENLKKRYMDDYIF - UNI13688 - TYIGSVLISVNPFKQMPYFGEKEV

EMYQGA - UNI1491 - AQYENPPHIYALADSMYRNMIIDRENQCVIIS SGESGAGKTVAAKYIMSYVSRVSGGGPKVQ HVKDIILQSNPLLEAFG

NAKTVRNNNSSRF GKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQ LIEGASPEQKQSLGITSMDYYYYLSLSGSYKVDDIDDKRDF

QETL HAMNVIGIFSEEQTLVLQIVAGILHLGNISFKEVGNYAAVESEEF FLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTR

DALAKALHARVFDFLVD SINKAMEKDHEEYNIGVLDIYGFEIFQ KNGFEQFCINFVNEKLQQIFIELTLKAEQ EEYVQEGIRWTPIEYFNNKIVCDL

IESKV NPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQGFIIHHYAGK VSYDMDGFCERNRDVLFMDLIELMQSSEL LPFIKSL

FPENLQADKKGRPTTAGSKIK - UNI2567 - KQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESR RVKHQVEYLGLKENIRVRRAGYAYRRVFQ

KFLQR RYAILTKATWPVWRGDEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPES - UNI4098 - LFLLEEMRERKYDGYARVIQKTWRKFVARKKY

VQMREEA ASDLLLNKKERRRNSINRNFIGDYIGMEERPELQQFVGKREKIDFADTVTKYDRRFK GVKRDLLLTPKCLYLIGREKVKQGPDKGVVKEVL

KRRIEVERILSVSLS STMQDDIFILHEQEYDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNT TLELKLKKENWGPWSAGGSRQVQFHQGFGDLAI

LKPSNKVLQVSIGPGLPKNSR RPTRRNTVTSRGYPGGTKNNYPMRAAPAPPG - UNI5033 - GCHQNGVIRNQFVPPPHAFGNQRSNQKSLYTSMA

RPPLPRQQSTGSDRLSQTPESLDFLKVPDQGVAG GVRRQTSSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKED - UNI1

5419 - DPSGWWTGRLRGKQGLFPNNYVTKI

For any suggestions or comments, please send an email to unitrap@crg.es