Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032228 (Tcf12)
Chromosomal location
Chr 9: 71693560 - 71959426 (-)
Description
transcription factor 12 Gene [Source:MGI Symbol;Acc:MGI:101877]
RefSeq_dna
NM_011544 
RefSeq_peptide
NP_035674.2 
UniGene
Mm.171615 
MGI
MGI:101877 
Uniprot/SWISSPROT
Q61286 
Uniprot/SPTREMBL
Q3UZA4 Q8BP24 Q3TE72 Q3UXQ3 Q3UZ69 Q8K1X3 
Human Ortholog
ENSG00000140262 (TCF12)
Omim not available
UniTrap UNI4546
Vector Insertion
Chr 9: 71791826 - 71848222
Public Clones AJ0492 (sanger) (egtc) IST11360E10 (tigm) IST14532F1 (tigm) IST10879B10 (tigm)
IST11001B3 (tigm) IST14312C10 (tigm) IST11066A9 (tigm) IST14714G3 (tigm)
IST14434E2 (tigm) IST11066E8 (tigm) IST11635G3 (tigm) IST10860F1 (tigm)
Private Clones OST68111 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1466
Vector Insertion
Chr 9: 71770595 - 71791760
Public Clones CD0455 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8113
Vector Insertion
Chr 9: 71743806 - 71764811
Public Clones RRG159 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13708
Vector Insertion
Chr 9: 71733096 - 71743736
Public Clones CMHD-GT_265B2-3 (cmhd) PST4665-NR (escells) IST11632B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19987
Vector Insertion
Chr 9: 71731603 - 71732989
Public Clones not available
Private Clones OST375779 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25652
Vector Insertion
Chr 9: 71723875 - 71730523
Public Clones not available
Private Clones OST171510 (lexicon) OST137596 (lexicon) OST9629 (lexicon) OST7251 (lexicon)
OST1987 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064957
Sequence
ATGTACTGTGCTTATCCTGTCCCTGGAATGGGCAACAATTCTTTGATGTATTACTACAATGGGAAAACG - UNI13708 - GTATATGCACCATCCCC

AAATTCTGACGATTTCAACCGTGAATCTCCTAGTTACCCATCTCCCAAGCCACCAACCAGTATGTTCGCTAGCACTTTCTTTATGCAAG - UNI19987

 - ATGGGACCCACAGTTCTTCTGACCTTTGGAGTTCATCGAATGGGATGAGCCAGCCTGGTTTTGGTGGAATTCTGGGGACCTCCACATCCCACATGTC

TCAGTCCAGTAGTTATGGCAGCCTTCATTCACATGACCGCTTG AGTTATCCTCCACACTCAGTGTCACCAACAGACATAAACACAAGTCTTCCGCCAAT

GTCCAGCTTCCACCGTGGTAGTACCAGCAGCTCACCATATGTTGCCGCCTCACATACTCCTCCCATCAATGGATCAGATAGCATCCTAG GAACCAGAGG

GAATGCTGCTGGAAGCTCACAGACGGGTGATGCACTTGGGAAGGCCTTGGCATCT - UNI25652 - ATTTATTCCCCTGACCACACAAGCAGTAGTT

TTCCATCAAACCCATCAACACCAGTGGGATCTCCTTCACCTCTCACAG GTACCAGTCAGTGGCCCAGAGCTGGAGGGCAAGCTCCTTCATCTCCAAGCT

ATGAAAACTCACTTCACTCCCTG AAAAATCGAGTTGAGCAGCAACTTCACGAGCATTTGCAAGATGCAATGTCCTTCTTAAAGGATGTCTGTGAG CAG

TCTCGAATGGAAGACCGCTTAGACAGGCTGGATGATGCTATCCATGTGCTACGAAACCATGCAGTTGGACCTTCTACCAGTCTGCCTACTAGCCACAGTG

ACATACACAGTTTGCTGGGACCATCCCATAATGCATCAATTGGAAACCTCAATTCAAACTATGGAGGATCCAGCCTTGTTACAAATAGTCGATCAGCTTC

GATG GTCGGAACACATCGGGAAGATTCAGTCAGTCTCAATGGCAATCATTCGGTCCTGTCTAGTACTGTTGCTGCCTCAAACACAGAACTGAACCATAA

AACACCAGAAAATTTCAGAG GTGGTGTACAAAATCAGTCTGGAAGTGTTGTTCCAACAGAAATCAAGACTGAAAACAAAGAAAAAGATGAAAACCTTCA

TGAACCTCCTTCATCAGATGACATGAAATCAGATGATGAGTCCTCCCAGAAAGACATCAAGGTCTCATCTAGGGGCAGAACAAG CAGTACCAATGAAGA

CGAGGATCTGAATCCAGAACAGAAAATCGAAAGGGAGAAGGAAAGGCGGATGGCTAACAATGCCAGAGAGCGCCTGCGCGTGCGGGATATTAACGAGGCG

TTCAAGGAGCTTGGCCGAATGTGTCAGCTTCATTTGAAGAGTGAAAAACCTCAGACAAAACTTCTCATTCTTCATCAGGCCGTGGCAGTCATCCTTAGTC

TAGAACAGCAAGTGAGAG AGAGGAACCTCAACCCCAAAGCAGCCTGCCTTAAGAGAAGAGAAGAAGAAAAAGTCTCTGCTGCGTCAGCAGAGCCGCCCA

ACACGTTGCCAGGAGCCCATCCTGGGCTTAGTGAGTCTACCAACCCTATGGGTCATCTGTAAACATCAGCCAG TTCCAGAGTCATCAGTAGGCTAAATA

GAAGGTGACCTCTCCTCATAAGATTTGGACAACTCAGATTATCTGAAGACACAAACCTGGCAGGAGGGAGAAGAAAAAGCAAAACACTTGAAACCAGAAA

CTCATATGTAATCCTGTGATCAAAGCAACTGGTCAGCACTTCATCAGACGTGAGCATAGGAAGCTCAGCAGAGACCGTCGGCCGTGAGGTGTTTGCAGCA

TATCACTCTGCTGTAATCAGTGTGTCGCTTCTGCACAATCAGAGACTGTCTCATCTCTCCACTCAACGTGGAAGTTGCCTTGTGCCTAAACTGAATTGAC

AAATGCATTGTAACTACAAATTTTATTTATTGTTATGGAACTGTGAGGTCTACATATAAAGGGAAAAGTTCATGTGGGAAGCTGATGTACACTCAGCTGA

TGCCAGCATTGTTAAAGCTGTTCACAGAGCAGTGGCAACCATTGGCCCTTAGCATTCCCGGCATACCTGTTAGTGTCTTAAAAAGGAAGGGAGTCCTTTG

TTGCCCTCTCCGACCTTCGCCATATGAATAGTGATTTCCATGAAATAGGAAAAATATTACTTCGTATAGCATTTCTCTCTTGTTTTTTTCACTCATTTTT

ATTTCCTCTTTGTGGGTGTTATATTTGATCTGAGTCTGCATAGTTTATGGTCACAGTCCAGAACCCTCCTTGCAGTCCTGTATGCTTTGTTCATGTCCTT

GAAGTGATAAGCAGACACCATCTGTGACCATAGCCTAGCTAATATTTTGAAAGGGGAAGTTTTGTCCCCTGGATTTGCCCCC
Translation
MYCAYPVPGMGNNSLMYYYNGKT - UNI13708 - VYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQD - UNI19987 - DGTHSSSDLWSSS

NGMSQPGFGGILGTSTSHMSQSSSYGSLHSHDRL SYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILG GTRGNAAGSSQTGDA

LGKALAS - UNI25652 - IYSPDHTSSSFPSNPSTPVGSPSPLTG GTSQWPRAGGQAPSSPSYENSLHSL KNRVEQQLHEHLQDAMSFLKDVCE 

QSRMEDRLDRLDDAIHVLRNHAVGPSTSLPTSHSDIHSLLGPSHNASIGNLNSNYGGSSLVTNSRSASM VGTHREDSVSLNGNHSVLSSTVAASNTELN

HKTPENFRG GGVQNQSGSVVPTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTS SSTNEDEDLNPEQKIEREKERRMANNARERLRVR

DINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRE ERNLNPKAACLKRREEEKVSAASAEPPNTLPGAHPGLSESTNPMGHL 
Transcript ENSMUST00000113549
Sequence
GTGAACTTTAATCGGGAAGGTTGGATGCGGAGCCCGGGCGGCAG GACCTGCTAGAAGTGGCTGAAGATGAATCCCCAGCAGCAGCGCATGGCCGCGATA

GGGACCGACAAGGAGCTGAGCGACCTGCTGGACTTCAGTGCG ATGTTTTCTCCACCTGTTAATAGTGGGAAAACGAGACCAACAACACTGGGAAGTAGT

CAGTTCAGCGGGTCAG GTATGGATGAGCGTGGAGGAACAACATCTTGGGGAACAAGTGGTCAACCAAGCCCCTCCTATGATTCATCTAGA GGTTTTAC

AGACAGCCCTCATTACAGTGATCACTTGAATGACAGTCGATTAGGAACCCACGAAGGCTTGTCCCCAACACCTTTCATGAACTCAAATCTGATAG - UN

I4546 - GGAAAACATCAGAGAGAGGCTCATTTTCCCTGTACAGCAGAGACTCTGGACTCTCAGGCTGTCAG - UNI1466 - TCTAGTCTCCTGAG

ACAAGATCTAGGACTTGGGAGCCCGGCACAGCTGTCTTCTTCAGGAAAGCCTGGAACACCATACTACTCATTCTCTGCCACAAGTTCGAGAAGAAGACCG

CTCCATGATTCTGTAGCCCTAG ATCCTTTACAAGCGAAGAAAGTAAGAAAGGTGCCTCCTGGCCTACCTTCTTCT - UNI8113 - - UNI13708 

- GTATATGCACCATCCCCAAATTCTGACGATTTCAACCGTGAATCTCCTAGTTACCCATCTCCCAAGCCACCAACCAGTATGTTCGCTAGCACTTTCTT

TATGCAAG - UNI19987 - ATGGGACCCACAGTTCTTCTGACCTTTGGAGTTCATCGAATGGGATGAGCCAGCCTGGTTTTGGTGGAATTCTGGGGA

CCTCCACATCCCACATGTCTCAGTCCAGTAGTTATGGCAGCCTTCATTCACATGACCGCTTG AGTTATCCTCCACACTCAGTGTCACCAACAGACATAA

ACACAAGTCTTCCGCCAATGTCCAGCTTCCACCGTGGTAGTACCAGCAGCTCACCATATGTTGCCGCCTCACATACTCCTCCCATCAATGGATCAGATAG

CATCCTAG GAACCAGAGGGAATGCTGCTGGAAGCTCACAGACGGGTGATGCACTTGGGAAGGCCTTGGCATCT - UNI25652 - ATTTATTCCCCT

GACCACACAAGCAGTAGTTTTCCATCAAACCCATCAACACCAGTGGGATCTCCTTCACCTCTCACAG GTACCAGTCAGTGGCCCAGAGCTGGAGGGCAA

GCTCCTTCATCTCCAAGCTATGAAAACTCACTTCACTCCCTG CAGTCTCGAATGGAAGACCGCTTAGACAGGCTGGATGATGCTATCCATGTGCTACGA

AACCATGCAGTTGGACCTTCTACCAGTCTGCCTACTAGCCACAGTGACATACACAGTTTGCTGGGACCATCCCATAATGCATCAATTGGAAACCTCAATT

CAAACTATGGAGGATCCAGCCTTGTTACAAATAGTCGATCAGCTTCGATG GTCGGAACACATCGGGAAGATTCAGTCAGTCTCAATGGCAATCATTCGG

TCCTGTCTAGTACTGTTGCTGCCTCAAACACAGAACTGAACCATAAAACACCAGAAAATTTCAGAG GTGGTGTACAAAATCAGTCTGGAAGTGTTGTTC

CAACAGAAATCAAGACTGAAAACAAAGAAAAAGATGAAAACCTTCATGAACCTCCTTCATCAGATGACATGAAATCAGATGATGAGTCCTCCCAGAAAGA

CATCAAGGTCTCATCTAGGGGCAGAACAAG CAGTACCAATGAAGACGAGGATCTGAATCCAGAACAGAAAATCGAAAGGGAGAAGGAAAGGCGGATGGC

TAACAATGCCAGAGAGCGCCTGCGCGTGCGGGATATTAACGAGGCGTTCAAGGAGCTTGGCCGAATGTGTCAGCTTCATTTGAAGAGTGAAAAACCTCAG

ACAAAACTTCTCATTCTTCATCAGGCCGTGGCAGTCATCCTTAGTCTAGAACAGCAAGTGAGAG AGAGGAACCTCAACCCCAAAGCAGCCTGCCTTAAG

AGAAGAGAAGAAGAAAAAGTCTCTGCTGCGTCAGCAGAGCCGCCCAACACGTTGCCAGGAGCCCATCCTGGGCTTAGTGAGTCTACCAACCCTATGGGTC

ATCTGTAAACATCAGCCAG TTCCAGAGTCATCAGTAGGCTAAATAGAAGGTGACCTCTCCTCATAAGATTTGGACAACTCAGATTATCTGAAGACACAA

ACCTGGCAGGAGGGAGAAGAAAAAGCAAAACACTTGAAACCAGAAACTCATATGTAATCCTGTGATCAAAGCAACTGGTCAGCACTTCATCAGACGTGAG

CATAGGAAGCTCAGCAGAGACCGTCGGCCGTGAGGTGTTTGCAGCATATCACTCTGCTGTAATCAGTGTGTCGCTTCTGCACAATCAGAGACTGTCTCAT

CTCTCCACTCAACGTGGAAGTTGCCTTGTGCCTAAACTGAATTGACAAATGCATTGTAACTACAAATTTTATTTATTGTTATGGAACTGTGAGGTCTACA

TATAAAGGGAAAAGTTCATGTGGGAAGCTGATGTACACTCAGCTGATGCCAGCATTGTTAAAGCTGTTCACAGAGCAGTGGCAACCATTGGCCCTTAGCA

TTCCCGGCATACCTGTTAGTGTCTTAAAAAGGAAGGGAGTCCTTTGTTGCCCTCTCCGACCTTCGCCATATGAATAGTGATTTCCATGAAATAGGAAAAA

TATTACTTCGTATAGCATTTCTCTCTTGTTTTTTTCACTCATTTTTATTTCCTCTTTGTGGGTGTTATATTTGATCTGAGTCTGCATAGTTTATGGTCAC

AGTCCAGAACCCTCCTTGCAGTCCTGTATGCTTTGTTCATGTCCTTGAAGTGATAAGCAGACACCATCTGTGACCATAGCCTAGCTAATATTTTGAAAGG

GGAAGTTTTGTCCCCTGGATTTGCCCCC
Translation
 MNPQQQRMAAIGTDKELSDLLDFSA MFSPPVNSGKTRPTTLGSSQFSGSG GMDERGGTTSWGTSGQPSPSYDSSR GFTDSPHYSDHLNDSRLGTHE

GLSPTPFMNSNLIG - UNI4546 - GKTSERGSFSLYSRDSGLSGCQ - UNI1466 - SSLLRQDLGLGSPAQLSSSGKPGTPYYSFSATSSRRRP

LHDSVALD DPLQAKKVRKVPPGLPSS - UNI8113 - - UNI13708 - VYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQD - UNI19987

 - DGTHSSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGSLHSHDRL SYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILG

 GTRGNAAGSSQTGDALGKALAS - UNI25652 - IYSPDHTSSSFPSNPSTPVGSPSPLTG GTSQWPRAGGQAPSSPSYENSLHSL QSRMEDRLD

RLDDAIHVLRNHAVGPSTSLPTSHSDIHSLLGPSHNASIGNLNSNYGGSSLVTNSRSASM VGTHREDSVSLNGNHSVLSSTVAASNTELNHKTPENFRG

 GGVQNQSGSVVPTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTS SSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKEL

GRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRE ERNLNPKAACLKRREEEKVSAASAEPPNTLPGAHPGLSESTNPMGHL 
Transcript ENSMUST00000034755
Sequence
GTGAACTTTAATCGGGAAGGTTGGATGCGGAGCCCGGGCGGCAG GACCTGCTAGAAGTGGCTGAAGATGAATCCCCAGCAGCAGCGCATGGCCGCGATA

GGGACCGACAAGGAGCTGAGCGACCTGCTGGACTTCAGTGCG ATGTTTTCTCCACCTGTTAATAGTGGGAAAACGAGACCAACAACACTGGGAAGTAGT

CAGTTCAGCGGGTCAG GTATGGATGAGCGTGGAGGAACAACATCTTGGGGAACAAGTGGTCAACCAAGCCCCTCCTATGATTCATCTAGA GGTTTTAC

AGACAGCCCTCATTACAGTGATCACTTGAATGACAGTCGATTAGGAACCCACGAAGGCTTGTCCCCAACACCTTTCATGAACTCAAATCTGATAG - UN

I4546 - GGAAAACATCAGAGAGAGGCTCATTTTCCCTGTACAGCAGAGACTCTGGACTCTCAGGCTGTCAG - UNI1466 - TCTAGTCTCCTGAG

ACAAGATCTAGGACTTGGGAGCCCGGCACAGCTGTCTTCTTCAGGAAAGCCTGGAACACCATACTACTCATTCTCTGCCACAAGTTCGAGAAGAAGACCG

CTCCATGATTCTGTAGCCCTAG ATCCTTTACAAGCGAAGAAAGTAAGAAAGGTGCCTCCTGGCCTACCTTCTTCT - UNI8113 - - UNI13708 

- GTATATGCACCATCCCCAAATTCTGACGATTTCAACCGTGAATCTCCTAGTTACCCATCTCCCAAGCCACCAACCAGTATGTTCGCTAGCACTTTCTT

TATGCAAG - UNI19987 - ATGGGACCCACAGTTCTTCTGACCTTTGGAGTTCATCGAATGGGATGAGCCAGCCTGGTTTTGGTGGAATTCTGGGGA

CCTCCACATCCCACATGTCTCAGTCCAGTAGTTATGGCAGCCTTCATTCACATGACCGCTTG AGTTATCCTCCACACTCAGTGTCACCAACAGACATAA

ACACAAGTCTTCCGCCAATGTCCAGCTTCCACCGTGGTAGTACCAGCAGCTCACCATATGTTGCCGCCTCACATACTCCTCCCATCAATGGATCAGATAG

CATCCTAG GAACCAGAGGGAATGCTGCTGGAAGCTCACAGACGGGTGATGCACTTGGGAAGGCCTTGGCATCT - UNI25652 - ATTTATTCCCCT

GACCACACAAGCAGTAGTTTTCCATCAAACCCATCAACACCAGTGGGATCTCCTTCACCTCTCACAG GTACCAGTCAGTGGCCCAGAGCTGGAGGGCAA

GCTCCTTCATCTCCAAGCTATGAAAACTCACTTCACTCCCTG AAAAATCGAGTTGAGCAGCAACTTCACGAGCATTTGCAAGATGCAATGTCCTTCTTA

AAGGATGTCTGTGAG CAGTCTCGAATGGAAGACCGCTTAGACAGGCTGGATGATGCTATCCATGTGCTACGAAACCATGCAGTTGGACCTTCTACCAGT

CTGCCTACTAGCCACAGTGACATACACAGTTTGCTGGGACCATCCCATAATGCATCAATTGGAAACCTCAATTCAAACTATGGAGGATCCAGCCTTGTTA

CAAATAGTCGATCAGCTTCGATG GTCGGAACACATCGGGAAGATTCAGTCAGTCTCAATGGCAATCATTCGGTCCTGTCTAGTACTGTTGCTGCCTCAA

ACACAGAACTGAACCATAAAACACCAGAAAATTTCAGAG GTGGTGTACAAAATCAGTCTGGAAGTGTTGTTCCAACAGAAATCAAGACTGAAAACAAAG

AAAAAGATGAAAACCTTCATGAACCTCCTTCATCAGATGACATGAAATCAGATGATGAGTCCTCCCAGAAAGACATCAAGGTCTCATCTAGGGGCAGAAC

AAG CAGTACCAATGAAGACGAGGATCTGAATCCAGAACAGAAAATCGAAAGGGAGAAGGAAAGGCGGATGGCTAACAATGCCAGAGAGCGCCTGCGCGT

GCGGGATATTAACGAGGCGTTCAAGGAGCTTGGCCGAATGTGTCAGCTTCATTTGAAGAGTGAAAAACCTCAGACAAAACTTCTCATTCTTCATCAGGCC

GTGGCAGTCATCCTTAGTCTAGAACAGCAAGTGAGAG AGAGGAACCTCAACCCCAAAGCAGCCTGCCTTAAGAGAAGAGAAGAAGAAAAAGTCTCTGCT

GCGTCAGCAGAGCCGCCCAACACGTTGCCAGGAGCCCATCCTGGGCTTAGTGAGTCTACCAACCCTATGGGTCATCTGTAAACATCAGCCAG TTCCAGA

GTCATCAGTAGGCTAAATAGAAGGTGACCTCTCCTCATAAGATTTGGACAACTCAGATTATCTGAAGACACAAACCTGGCAGGAGGGAGAAGAAAAAGCA

AAACACTTGAAACCAGAAACTCATATGTAATCCTGTGATCAAAGCAACTGGTCAGCACTTCATCAGACGTGAGCATAGGAAGCTCAGCAGAGACCGTCGG

CCGTGAGGTGTTTGCAGCATATCACTCTGCTGTAATCAGTGTGTCGCTTCTGCACAATCAGAGACTGTCTCATCTCTCCACTCAACGTGGAAGTTGCCTT

GTGCCTAAACTGAATTGACAAATGCATTGTAACTACAAATTTTATTTATTGTTATGGAACTGTGAGGTCTACATATAAAGGGAAAAGTTCATGTGGGAAG

CTGATGTACACTCAGCTGATGCCAGCATTGTTAAAGCTGTTCACAGAGCAGTGGCAACCATTGGCCCTTAGCATTCCCGGCATACCTGTTAGTGTCTTAA

AAAGGAAGGGAGTCCTTTGTTGCCCTCTCCGACCTTCGCCATATGAATAGTGATTTCCATGAAATAGGAAAAATATTACTTCGTATAGCATTTCTCTCTT

GTTTTTTTCACTCATTTTTATTTCCTCTTTGTGGGTGTTATATTTGATCTGAGTCTGCATAGTTTATGGTCACAGTCCAGAACCCTCCTTGCAGTCCTGT

ATGCTTTGTTCATGTCCTTGAAGTGATAAGCAGACACCATCTGTGACCATAGCCTAGCTAATATTTTGAAAGGGGAAGTTTTGTCCCCTGGATTTGCCCC

C
Translation
 MNPQQQRMAAIGTDKELSDLLDFSA MFSPPVNSGKTRPTTLGSSQFSGSG GMDERGGTTSWGTSGQPSPSYDSSR GFTDSPHYSDHLNDSRLGTHE

GLSPTPFMNSNLIG - UNI4546 - GKTSERGSFSLYSRDSGLSGCQ - UNI1466 - SSLLRQDLGLGSPAQLSSSGKPGTPYYSFSATSSRRRP

LHDSVALD DPLQAKKVRKVPPGLPSS - UNI8113 - - UNI13708 - VYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQD - UNI19987

 - DGTHSSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGSLHSHDRL SYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILG

 GTRGNAAGSSQTGDALGKALAS - UNI25652 - IYSPDHTSSSFPSNPSTPVGSPSPLTG GTSQWPRAGGQAPSSPSYENSLHSL KNRVEQQLH

EHLQDAMSFLKDVCE QSRMEDRLDRLDDAIHVLRNHAVGPSTSLPTSHSDIHSLLGPSHNASIGNLNSNYGGSSLVTNSRSASM VGTHREDSVSLNGN

HSVLSSTVAASNTELNHKTPENFRG GGVQNQSGSVVPTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTS SSTNEDEDLNPEQKIERE

KERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRE ERNLNPKAACLKRREEEKVSAASAEPPNTLPGAHPGLS

ESTNPMGHL 

For any suggestions or comments, please send an email to unitrap@crg.es