Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032232 (Cgnl1)
Chromosomal location
Chr 9: 71474316 - 71619409 (-)
Description
cingulin-like 1 Gene [Source:MGI (curated);Acc:Cgnl1-003]
RefSeq_dna
NM_026599 
RefSeq_peptide
NP_080875.3 
UniGene
Mm.99961 
MGI
MGI:1915428 
Uniprot/SWISSPROT
Q6AW69 
Uniprot/SPTREMBL
B2RSU6 B2RY19 
Human Ortholog
ENSG00000128849 (CGNL1)
Omim 139300 - AROMATASE EXCESS SYNDROME  
UniTrap UNI13656
Vector Insertion
Chr 9: 71572284 - 71573890
Public Clones CMHD-GT_297D6-3 (cmhd)
Private Clones OST449154 (lexicon) OST347978 (lexicon) OST257961 (lexicon) OST212032 (lexicon)
OST210147 (lexicon) OST208933 (lexicon) OST193918 (lexicon) OST181547 (lexicon)
OST134784 (lexicon) OST127016 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32135
Vector Insertion
Chr 9: 71572284 - 71619368
Public Clones IST14139F1 (tigm) IST14772D10 (tigm) IST10462D2 (tigm) IST14209G12 (tigm)
IST14413C1 (tigm) IST14297D4 (tigm) IST14168C9 (tigm) IST14687A1 (tigm)
IST10918A2 (tigm) IST11015C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122065
Sequence
CCGGCCCGGCTCTGCGGGCAGCTGCCGGAGCGGGACCCTGGAGGCAGAGGCGGTAAGTGAGCTCCGAGCGGGAGCCCGGAGGGTGTGCGCGGGACCCCGG

AGCCCAGACGGTGCCCGGGAACTCGACAGGCTCGAGCTCCTGCAGCTTTGCGCAGTGCTCAGCCTCAGCGTCGGTCGTGGGATCCGGGCGCCGCGGCTGC

AGTCCCGGGGCTGGAGGTGCGCTCCTGCCTCCTACGCTGAGCCCAGTACTGCAGACGAGTCGGACAGTTGGTGGCGAGCCTGTACAGGGCTCTAGTGACA

GCTGCGGGCGAGCCCCACGGAGCACCGCACTCCCAACCCTTCCCTGCAGTGTTTGATCTCAGTGCTCTTTAAGCCATTCCTTAGAACAGGCTGGTGGCCG

CTCCGCTGTCCTGGCCCCGCGTGCCACTGCACTGTCCAGGCAGGTCACCCCGAAAGCCCTTAAACCACGAGAGCACTTTTTTCGCTTTCTGAGGGACTTT

TCCAAGTTGCATCACCGTTTGGCTTCAAG - UNI13656 - - UNI32135 - CTGGGACAGAGAACCATGGAGCTGTATTTTGGCGAATACCAACA

CGTACAGCAGGAGTACGGGGTACACCTGAGACTTGCCAGTGGTGACACTCCAAAGCCAAGGAATTCCCAGCCCTCAAAGGCAGGCTCCTATGGTGTCAGC

ATCAGGGTCCAGGGAATTGATGGCCACCCTTATATAGTCCTGAATAACACTGAGCGGTGTCTAGCAGGCACACCTTTCCCAGAAAACGCGCCATCGTTTC

CATCTTCAGTGATAAATAACCTGTCCCTACATCCAAGCAATGGAACCGTGTTGAAGGAGAACACTCCGGAGGAACTGCAGCTTCCAGAAAACCCGTACCT

GCAAACCAGCCCGCTAAGAGGCCAGAAGCAGTTCTCCCTCCACGAGGGCAGGAATGGAGTTCTAGAACGCAAAGACGGGCCCACGAAGCTGCCCCATGTG

CTCAACTTCCAGAGGCACCCGGAGCTTCTGCAGCCCTATGACCCAGAAAAGAATGAGGTGAACGCAAAGAAGCATCACCCTCCCGAGAGTCCCTGGCTGA

GAAATGCAACAGAGGACGGGACCAACTGTAAGAAGTCCCGGAACTGCTTCCCCAAATCCTACGGTTCCCAGCCCAACAGCCCTACTTCGGAAGATTTAGC

CAAGACCAACATGACAGCGATCCGTCTCTGCAGCTCTGTGGTCATAGAAGACCCCCAAAAGCAGACCTCAGTGTGCGTGAACGTTCAGAGGTGCGCCAAG

GAGGGGGTGGGAGAGGAGACCCTTTCCCCTCGACGGAAATCCCCAACTGCCCCCAGCCCACAGGCCTATTCTGAAACCAAGAAAAACAGGCCAGATGTGC

TACCCTTCCGGCGACAAGATTCCGCAGGACCCATCCTGGATGGAGCTCGGTCACGCAGGTCCTCTTCGTCATCCACGACTCCTACTTCTGCCACTTCCTT

GTACAAATTTTTACTTGATGATCAGGAATGCGCCATTCATGCCGACAGCGTCAACCGCCATGAAAACAGAAGGTATATTCCCTTCTTGCCAGGAACTGGG

CGGGATATCGACACCTGCTCAATTCCTGGTGTGGACCAGTTAATTGAAAAATTTGACCAAAAGCCTGGCCTTCAGAGAAGAGGAAGGTCTGGGAAGAGAA

ACAGGATCAATCCCGACGACAGGAAAAGATCCCGAAGTGTAGATAGTGCCTTTCCATTTGGTCTCCAGGGAAACACAGAATACCTCACCGAGTTCAGCAG

GAACCTGGGCAAGTCTAGCGAACACCTCCTTCGGCCATCCCAGGTCTTCCCGCAGAGGTCAGTGGCCCAGGAGCACCGTGGGAAGCACAGTCCCAGCAGC

CCGCCCGCAAAGCTGCAGGGCGCTCAAGGTGCCCACCCCAAGCCTCCCCTGCAGAACAAAGATGGGAAAGTTCTGAACAAAGGAAGGCAGGAAAGCACGG

GGGCATGTGCCCCCTCCCTGCCAGCACCGAATAAAAAAGAGGAAGAAATCAAAATAGCCACTGCCACGTTGATGTTACAGAACCGGGCGGTGGCTGCCAC

ATCGGATTCTGGTGCCAAGAAAATTTCAGTGAAGACATTTCCTTCCGACTCCAGCACTCAG - UNI13656 - - UNI32135 - GCCACACCAGAT

CTCTTAAAGGGCCAGCAGGAGCTCACACAACAAACGAACGAGGAGACCGCCAAGCAGATCCTTTACAATTACCTCAAAGAAGG AGGCACAGACAATGAG

GATGCCACCAAAAGGAAAGTGAACCTGGTCTTTGAGAAAATCCAGACTTTGAAGTCCAGAGCAGCAGGGAGTGCCCAAGGAAGCAATCAA GCTCCGAAT

TCTCCCTCTGAAGGCAACAGTCTATTGGATCAGAAGAACAAATTGATCCTAGAAGTGTCTGAACTACAGCAGCAACTGCAACTGGAGATGAAG AACCAA

CAGAACATCAAGGAGGAGCGAGAAAGAATGAGAGAGGATTTAGAAGAGCTGCGAGTCCGGCACCAGAGCCAAGTGGAGGAGACGGCCACCCTGCAGAGAC

GGCTGGAGGAAAGTGAAGGCGAGCTGAGGAAGAGCTTGGAAGA GCTGTTCCAAGTGAAGATGGAGCGTGAACAGCACCAGACTGAGATCAGAGACCTGC

AGGACCAGCTGTCGGAAATGCATGATGAGCTAGACAGCACCAAGCGATCCGAGGACAGGGAGAAGGGAGCCCTGATTGAG GAGCTCCTGCAAGCCAAGC

AGGACCTTCAAGATCTGCTCATTGCCAAAGAGGAACAGGAAGATCTCTTGAGGAAGCGGGAGCGGGAGCTGACTGCCTTGAAGGGCGCCTTGAAGGAGGA

GGTTTCCAGCCATGACCAGGAGATGGATAAGCTGAAGGAACAGTACGATGCTGAGCTGCAGGCCCTCAGGGAGAGTGTGGAGGAGGCAACCAAG AATGT

TGAGGTCCTGGCCAGCAGGAGCAACTCCTCAGAGCAGAGCCAGGCGGAGGCTGACCTGCGTGAGAAAGTGCTGAAGGAGGAGAATGAGAAGCTGCAGGGG

AGGATTGCGGAGCTGGAGCGCAGGGCAGCCCAGCTACAGAGGCAGATGGAGGATGTGAAGGGTGACGAGGCCCAAGCAAAGGAGACACTCCGAAAGTGTG

AG AGTGAAGTACAGCAGCTGGAGGAAGCCCTTGTGCATGCCAGAAAGGAAGAAAAAGAAGCCACATGTGCCAGAAGGGCGCTGGAGAAGGAGCTGGAGC

AAGCTCGG AGAGAGCTGAGCCAGGTCTCCCAGGAGCAGAAGGAACTCCTGGAGAAACTCCGGGACGAGGCGGAGCAGAAGGAGCAGCTGCGAAAGCTGA

AGAACGAGATGGAGAGCGAGCGGTGGCACCTGGACAAGACCATCGAGAAGCTGCAGAAGGAG ATGGCCGACATTGCTGAGGCCTCCCGCACATCCTCTT

TGGAGCTGCAGAAGCAGCTGGGCGAGTATAAGGAGAAGAACCGCCGGGAGCTTGCGGAAATGCAGACACAACTGAAGGAGAAATGCCTGGAAGTGGAAAA

GGCCAGACTGGCAGCCTCGAAGATGCAGGATGAG TTACGCCTCAAGGAGGAAGAGTTGCAGGACTACCAGCGAGCTGAGGAGGAGGCGCTCACAAAACG

GCAGCTTCTGGAGCAGTCGCTGAAGGACCTGGAGTATGAGCTGGAGGCCAAGAGCCACCTCAAGGATGACCGCAGCCGACTCATCAAGCAGATGGAG GA

CAAGGTGTCCCAATTGGAGATTGAATTGGAAGAAGAAAGAACCAACGCTGACTTGCTGTCGGAGAGGATCACGTGGAGCAGGGAACAG ATGGAGCAGAT

GAGGAGCGAGCTTCTTCAGGAGAAAGCTGCCAAGCAAGACTTAGAGTGTGACAAGATTTCCCTAGAGAGACAG AACAAAGACTTAAAGAGCCGGATTAT

CCACCTGGAAGGTTCCTACAGGTCCAGCAAGGAGGGCCTGGTGGTGCAGATGGAGGCCAGGATTGCAGAGCTGGAGGACCGGCTGGAGAATGAGGAGAG 

GGATCGGGCCAACCTGCAGCTCAGCAACCGAAGGCTGGAGCGGAAGGTGAAGGAGCTGGTGATGCAGGTGGATGATGAGCATCTGTCACTGACGGACCAG

AAGGACCAG CTGAGCTTGCGCCTGAAAGCCATGAAGCGCCAGGTGGAGGAGGCTGAAGAGGAGATCGACCGACTGGAAAGTTCTAAGAAGAAGCTGCAG

AGGGAGCTGGAGGAGCAGATGGGGGTGAATGAGCAGCTGCAGGGGCAGCTCAACTCTCTGAAGAAGGGCTTAAG GCTTAAGACACTGTCTAGTAAAGTA

CTGGACGACTCGGACGACGACGACCTCAGCAGTGATGCGGGAAGCCTCTACGAAGCCCCACTGAGCTATGCCTTTCCCAAAGACAGCACTATCGCCAGCC

AGATCTGAGTCTGCTTCCAGGCCCGTTGATCCTGACAGGACTCTGCAGTCATCTAGA
Translation
 - UNI13656 - - UNI32135 - MELYFGEYQHVQQEYGVHLRLASGDTPKPRNSQPSKAGSYGVSIRVQGIDGHPYIVLNNTERCLAGTPFPENA

PSFPSSVINNLSLHPSNGTVLKENTPEELQLPENPYLQTSPLRGQKQFSLHEGRNGVLERKDGPTKLPHVLNFQRHPELLQPYDPEKNEVNAKKHHPPES

PWLRNATEDGTNCKKSRNCFPKSYGSQPNSPTSEDLAKTNMTAIRLCSSVVIEDPQKQTSVCVNVQRCAKEGVGEETLSPRRKSPTAPSPQAYSETKKNR

PDVLPFRRQDSAGPILDGARSRRSSSSSTTPTSATSLYKFLLDDQECAIHADSVNRHENRRYIPFLPGTGRDIDTCSIPGVDQLIEKFDQKPGLQRRGRS

GKRNRINPDDRKRSRSVDSAFPFGLQGNTEYLTEFSRNLGKSSEHLLRPSQVFPQRSVAQEHRGKHSPSSPPAKLQGAQGAHPKPPLQNKDGKVLNKGRQ

ESTGACAPSLPAPNKKEEEIKIATATLMLQNRAVAATSDSGAKKISVKTFPSDSSTQ - UNI13656 - - UNI32135 - ATPDLLKGQQELTQQT

NEETAKQILYNYLKEG GGTDNEDATKRKVNLVFEKIQTLKSRAAGSAQGSNQ APNSPSEGNSLLDQKNKLILEVSELQQQLQLEMK NQQNIKEERER

MREDLEELRVRHQSQVEETATLQRRLEESEGELRKSLEE ELFQVKMEREQHQTEIRDLQDQLSEMHDELDSTKRSEDREKGALIE ELLQAKQDLQDLL

IAKEEQEDLLRKRERELTALKGALKEEVSSHDQEMDKLKEQYDAELQALRESVEEATK NVEVLASRSNSSEQSQAEADLREKVLKEENEKLQGRIAELE

RRAAQLQRQMEDVKGDEAQAKETLRKCE SEVQQLEEALVHARKEEKEATCARRALEKELEQAR RELSQVSQEQKELLEKLRDEAEQKEQLRKLKNEME

SERWHLDKTIEKLQKE MADIAEASRTSSLELQKQLGEYKEKNRRELAEMQTQLKEKCLEVEKARLAASKMQDE LRLKEEELQDYQRAEEEALTKRQLL

EQSLKDLEYELEAKSHLKDDRSRLIKQME DKVSQLEIELEEERTNADLLSERITWSREQ MEQMRSELLQEKAAKQDLECDKISLERQ NKDLKSRIIH

LEGSYRSSKEGLVVQMEARIAELEDRLENEER RDRANLQLSNRRLERKVKELVMQVDDEHLSLTDQKDQ LSLRLKAMKRQVEEAEEEIDRLESSKKKL

QRELEEQMGVNEQLQGQLNSLKKGLR RLKTLSSKVLDDSDDDDLSSDAGSLYEAPLSYAFPKDSTIASQI
Transcript ENSMUST00000121322
Sequence
GGGGCTGGCGCGGCCTCCTGGCGACGCGGCGGCCGCTGCTCTCCGGCCCGGCTCTGCGGGCAGCTGCCGGAGCGGGACCCTGGAGGCAGAGGCG - UNI

13656 - - UNI32135 - CTGGGACAGAGAACCATGGAGCTGTATTTTGGCGAATACCAACACGTACAGCAGGAGTACGGGGTACACCTGAGACTTG

CCAGTGGTGACACTCCAAAGCCAAGGAATTCCCAGCCCTCAAAGGCAGGCTCCTATGGTGTCAGCATCAGGGTCCAGGGAATTGATGGCCACCCTTATAT

AGTCCTGAATAACACTGAGCGGTGTCTAGCAGGCACACCTTTCCCAGAAAACGCGCCATCGTTTCCATCTTCAGTGATAAATAACCTGTCCCTACATCCA

AGCAATGGAACCGTGTTGAAGGAGAACACTCCGGAGGAACTGCAGCTTCCAGAAAACCCGTACCTGCAAACCAGCCCGCTAAGAGGCCAGAAGCAGTTCT

CCCTCCACGAGGGCAGGAATGGAGTTCTAGAACGCAAAGACGGGCCCACGAAGCTGCCCCATGTGCTCAACTTCCAGAGGCACCCGGAGCTTCTGCAGCC

CTATGACCCAGAAAAGAATGAGGTGAACGCAAAGAAGCATCACCCTCCCGAGAGTCCCTGGCTGAGAAATGCAACAGAGGACGGGACCAACTGTAAGAAG

TCCCGGAACTGCTTCCCCAAATCCTACGGTTCCCAGCCCAACAGCCCTACTTCGGAAGATTTAGCCAAGACCAACATGACAGCGATCCGTCTCTGCAGCT

CTGTGGTCATAGAAGACCCCCAAAAGCAGACCTCAGTGTGCGTGAACGTTCAGAGGTGCGCCAAGGAGGGGGTGGGAGAGGAGACCCTTTCCCCTCGACG

GAAATCCCCAACTGCCCCCAGCCCACAGGCCTATTCTGAAACCAAGAAAAACAGGCCAGATGTGCTACCCTTCCGGCGACAAGATTCCGCAGGACCCATC

CTGGATGGAGCTCGGTCACGCAGGTCCTCTTCGTCATCCACGACTCCTACTTCTGCCACTTCCTTGTACAAATTTTTACTTGATGATCAGGAATGCGCCA

TTCATGCCGACAGCGTCAACCGCCATGAAAACAGAAGGTATATTCCCTTCTTGCCAGGAACTGGGCGGGATATCGACACCTGCTCAATTCCTGGTGTGGA

CCAGTTAATTGAAAAATTTGACCAAAAGCCTGGCCTTCAGAGAAGAGGAAGGTCTGGGAAGAGAAACAGGATCAATCCCGACGACAGGAAAAGATCCCGA

AGTGTAGATAGTGCCTTTCCATTTGGTCTCCAGGGAAACACAGAATACCTCACCGAGTTCAGCAGGAACCTGGGCAAGTCTAGCGAACACCTCCTTCGGC

CATCCCAGGTCTTCCCGCAGAGGTCAGTGGCCCAGGAGCACCGTGGGAAGCACAGTCCCAGCAGCCCGCCCGCAAAGCTGCAGGGCGCTCAAGGTGCCCA

CCCCAAGCCTCCCCTGCAGAACAAAGATGGGAAAGTTCTGAACAAAGGAAGGCAGGAAAGCACGGGGGCATGTGCCCCCTCCCTGCCAGCACCGAATAAA

AAAGAGGAAGAAATCAAAATAGCCACTGCCACGTTGATGTTACAGAACCGGGCGGTGGCTGCCACATCGGATTCTGGTGCCAAGAAAATTTCAGTGAAGA

CATTTCCTTCCGACTCCAGCACTCAG - UNI13656 - - UNI32135 - GCCACACCAGATCTCTTAAAGGGCCAGCAGGAGCTCACACAACAAAC

GAACGAGGAGACCGCCAAGCAGATCCTTTACAATTACCTCAAAGAAGG AGGCACAGACAATGAGGATGCCACCAAAAGGAAAGTGAACCTGGTCTTTGA

GAAAATCCAGACTTTGAAGTCCAGAGCAGCAGGGAGTGCCCAAGGAAGCAATCAA GCTCCGAATTCTCCCTCTGAAGGCAACAGTCTATTGGATCAGAA

GAACAAATTGATCCTAGAAGTGTCTGAACTACAGCAGCAACTGCAACTGGAGATGAAG AACCAACAGAACATCAAGGAGGAGCGAGAAAGAATGAGAGA

GGATTTAGAAGAGCTGCGAGTCCGGCACCAGAGCCAAGTGGAGGAGACGGCCACCCTGCAGAGACGGCTGGAGGAAAGTGAAGGCGAGCTGAGGAAGAGC

TTGGAAGA GCTGTTCCAAGTGAAGATGGAGCGTGAACAGCACCAGACTGAGATCAGAGACCTGCAGGACCAGCTGTCGGAAATGCATGATGAGCTAGAC

AGCACCAAGCGATCCGAGGACAGGGAGAAGGGAGCCCTGATTGAG AATGTTGAGGTCCTGGCCAGCAGGAGCAACTCCTCAGAGCAGAGCCAGGCGGAG

GCTGACCTGCGTGAGAAAGTGCTGAAGGAGGAGAATGAGAAGCTGCAGGGGAGGATTGCGGAGCTGGAGCGCAGGGCAGCCCAGCTACAGAGGCAGATGG

AGGATGTGAAGGGTGACGAGGCCCAAGCAAAGGAGACACTCCGAAAGTGTGAG AGTGAAGTACAGCAGCTGGAGGAAGCCCTTGTGCATGCCAGAAAGG

AAGAAAAAGAAGCCACATGTGCCAGAAGGGCGCTGGAGAAGGAGCTGGAGCAAGCTCGG AGAGAGCTGAGCCAGGTCTCCCAGGAGCAGAAGGAACTCC

TGGAGAAACTCCGGGACGAGGCGGAGCAGAAGGAGCAGCTGCGAAAGCTGAAGAACGAGATGGAGAGCGAGCGGTGGCACCTGGACAAGACCATCGAGAA

GCTGCAGAAGGAG ATGGCCGACATTGCTGAGGCCTCCCGCACATCCTCTTTGGAGCTGCAGAAGCAGCTGGGCGAGTATAAGGAGAAGAACCGCCGGGA

GCTTGCGGAAATGCAGACACAACTGAAGGAGAAATGCCTGGAAGTGGAAAAGGCCAGACTGGCAGCCTCGAAGATGCAGGATGAG TTACGCCTCAAGGA

GGAAGAGTTGCAGGACTACCAGCGAGCTGAGGAGGAGGCGCTCACAAAACGGCAGCTTCTGGAGCAGTCGCTGAAGGACCTGGAGTATGAGCTGGAGGCC

AAGAGCCACCTCAAGGATGACCGCAGCCGACTCATCAAGCAGATGGAG GACAAGGTGTCCCAATTGGAGATTGAATTGGAAGAAGAAAGAACCAACGCT

GACTTGCTGTCGGAGAGGATCACGTGGAGCAGGGAACAG ATGGAGCAGATGAGGAGCGAGCTTCTTCAGGAGAAAGCTGCCAAGCAAGACTTAGAGTGT

GACAAGATTTCCCTAGAGAGACAG AACAAAGACTTAAAGAGCCGGATTATCCACCTGGAAGGTTCCTACAGGTCCAGCAAGGAGGGCCTGGTGGTGCAG

ATGGAGGCCAGGATTGCAGAGCTGGAGGACCGGCTGGAGAATGAGGAGAG GGATCGGGCCAACCTGCAGCTCAGCAACCGAAGGCTGGAGCGGAAGGTG

AAGGAGCTGGTGATGCAGGTGGATGATGAGCATCTGTCACTGACGGACCAGAAGGACCAG CTGAGCTTGCGCCTGAAAGCCATGAAGCGCCAGGTGGAG

GAGGCTGAAGAGGAGATCGACCGACTGGAAAGTTCTAAGAAGAAGCTGCAGAGGGAGCTGGAGGAGCAGATGGGGGTGAATGAGCAGCTGCAGGGGCAGC

TCAACTCTCTGAAGAAGGGCTTAAG GCTTAAGACACTGTCTAGTAAAGTACTGGACGACTCGGACGACGACGACCTCAGCAGTGATGCGGGAAGCCTCT

ACGAAGCCCCACTGAGCTATGCCTTTCCCAAAGACAGCACTATCGCCAGCCAGATCTGAGTCTGCTTCCAGGCCCGTTGATCCTGACAGGACTCTGCAGT

CATCTAGACAGAGTAGGAGGCACTAAATAGAGCTTGTGAATGGAGTCAGACCCACGGTTACCACCTCACATTCCTCCTGGGGCCTCTGCGTGGTTGAGTG

ACCTTGGATCTTAGATAGGGAGCTATTGAAGTTTCAGATGACCTAACTGGGACATTTGGGGGTAAGACAAAGCCCCATTGTGCACTGCTGTCTGCCATCA

CTCCTTCTCCTGCCCCGGAGAAGGTTCCAGTGCCAGCTGTAATGATATAGGGACACATAGGGATGAAATGATGTATAGACTGAACCAGACCTTCTCAAGG

ACCGCTGTTCTCCTTAAGGATGCTCCAGAGCCTTTCGAGTATGACATCTTTGTAAAGTTCACAAACTGATCTTGATTATCTTTTAAAATATGAAGCTACC

AGATCTCAAGTATTAAGAAGCTGGAGGCAAAGGAGGGAGAGTGAAGGCTATTCTGGAAACCAGAGGGGGTCAGACAGTGGGAATCAATAATTGGTTTGTA

TGGGAAACCAGCTCATTGATGGTTGGGGAAGGACACTTAGGCGGAGTCTGAGGCCTTGGTTGCTTATTTTATCTGAACCATGCAAAGAGCAGTCCCTACT

CCCCACTGCTTTCAAGCAAGCAGAATGGGAGACAGATGAGATTTTTAACAAGTGCTGTGCTTCCTAAAGGACAAGAGCGCTGTTGTTGTGTCTCCTTGGC

CCTTTTCCTCCATGGCAGACCTCCAAGCGAAGCTCGCTCAGGCCTGGAATTGGAGGAATAGGAGGGGCCTTGAGACGAGGCCTATGGGCTTAGGTATGAG

GCTAAGGAGGGAGGCATCCAGGAAGTTCATGGGGCAGGGGATGAGTAAGTGGGTATGGGGCTGATGTAAGAAGGAATACAGAGACGTTCTTGAAAGCTGG

GGGATGTGCAAGAAGGGCAGGGGGTGGGGGTTGAGCTGGAGTTTGGAATGATGGGAAAAGGGATTGGGAGTGCTTGCCATCTGAAGGGCTGTTTTTGGGA

ACAGGTGTCAGGAAGGGGTGAGGTCCAAGGGCAAGCACATGATGCCAAGGTAGTTTTGGGAGGATGCTGGGCATCCCTGCATATCTCCTGGCCTACCCAT

GTCTCCTCATGACTGTGACAGTCACCTATGAAAGAGCCTTGTGAGTTGCCTATGTGTAAGGCAGAGGTGACAGGACACTGGAGCAGAGTCCTCAGGCTTC

CTGATATGGGGACTCCTGGGGACCAGGTTACCATAAGGTCCTGTCCACAGCAGGTCAGAGTTCACACAGCTAGATTCAGAGAAGGGATCTGAAGGATGAG

CATCTGCTGCCAGAGAACCAAGCCCTATTACACATCCCGAGATCCACTGTCTCCCTCGCCTGTCTCCTCACTGGGTATGGAGAGACTTCTGCTTTCAGCC

ATTCTTCCATGTAACAAGCATGTACTATCATCCATCAAAATGTGTCAGGCACAGACTTGGGCACTGGAAACACAGTAAATAGAAGTAAAAATGTTGAGCC

GGAAATGTAGCTCAGCTGGGGCAATGCGTGCCTAGCGTGCAGGAAGCCCTGTATTTAACCCCCAACTCTATAAACCGGGTGTGGTGTGGTATGCCTGTGA

TCCCAACACAGGAAGTGGCAACAGGAGGATCCAGAGTTCAAAGTCAGCCTTGGATACATATGCAGGTCTTGGCCAAGCTGGGTTATATAGGAGGCCCCGT

CTCAAAAAAACCCAACCAACCCTGCCCTCCTGTAACCATCCAGGAGAGTGTGATGCAGCCTGAACCTCTCTATACTCAGCCTCGGAGAACCTCTGTCCTC

TTGGGAATGTGATGGCCTGCGATTGGTTGGCTGGTTCCCCAGAACACACAGGAATTCTTTAGCTCCTAGAATCTTCTCATGTCATCATTCGATATTTGTA

CTCAGCCTAGAAATGTCTCAGCCTGCTCATCCCAGAGATTCAGGTGACAAAAATCAAGACCCCGAGGAAGGGTGTTTGTTTTGTGGTTTGACAAAAATTA

GCCAGCCCTTATTCCAGTCAGTTCCTTCTGGTAGCCATGGGGCTAACTATATGAAGGAAGATAGCTCGTGGAAGGGAGAGCAGAGGCCACCACTGGAAAC

ACTTGTAGAGTCCCTCACCCCACCACACACACACACACCAGAGGAGGCTAAACGAGATGAGGGCATGTCTCCTGTGCTGTAATGGAGTGGGCAGCGAGCC

GGTGTGTGCAGTATAGTCAGTGAGTGACGCGACACTGGAATGAGGTTTAGAACGAGGTTTGTAAGTCCCAGCCTCATCTCTTCCCTGTGATCCTGACAGG

TGCATCCTGGGACAAGGTGGCGATTAGGACTCCAGGTCCTTCTCAGCTCGAATCTGTTGAGCATCCCTTGGTCTTCTTATATATACATGTTTTTCTGTTT

ATTCCTTTAAGAACTAATCCTGCTCAAGAGCGTTTTCTTTAGCTAGCTTAAAAATATCTCCTGTAAAAACATACATGTTGCCAAGTGCAATGTTGAGAAG

ACAATCACTGTATGGCTTTTATAAATTTGTTTTTCCTGCTCTGGAGTGTCATTCCACCATGACAGTTGGAATATTCTGGTGGGTCTTTTAGTAGGGATTG

GTTACTATGCGTTGTCATGGGGAAGAGACATTTTTTATCACAGCTACCTCCATGGGAATGACTTCATGGATAAAGCAAGGTTTCCTTTCAATAAACTGTC

ACTTGACAGG
Translation
 - UNI13656 - - UNI32135 - MELYFGEYQHVQQEYGVHLRLASGDTPKPRNSQPSKAGSYGVSIRVQGIDGHPYIVLNNTERCLAGTPFPENA

PSFPSSVINNLSLHPSNGTVLKENTPEELQLPENPYLQTSPLRGQKQFSLHEGRNGVLERKDGPTKLPHVLNFQRHPELLQPYDPEKNEVNAKKHHPPES

PWLRNATEDGTNCKKSRNCFPKSYGSQPNSPTSEDLAKTNMTAIRLCSSVVIEDPQKQTSVCVNVQRCAKEGVGEETLSPRRKSPTAPSPQAYSETKKNR

PDVLPFRRQDSAGPILDGARSRRSSSSSTTPTSATSLYKFLLDDQECAIHADSVNRHENRRYIPFLPGTGRDIDTCSIPGVDQLIEKFDQKPGLQRRGRS

GKRNRINPDDRKRSRSVDSAFPFGLQGNTEYLTEFSRNLGKSSEHLLRPSQVFPQRSVAQEHRGKHSPSSPPAKLQGAQGAHPKPPLQNKDGKVLNKGRQ

ESTGACAPSLPAPNKKEEEIKIATATLMLQNRAVAATSDSGAKKISVKTFPSDSSTQ - UNI13656 - - UNI32135 - ATPDLLKGQQELTQQT

NEETAKQILYNYLKEG GGTDNEDATKRKVNLVFEKIQTLKSRAAGSAQGSNQ APNSPSEGNSLLDQKNKLILEVSELQQQLQLEMK NQQNIKEERER

MREDLEELRVRHQSQVEETATLQRRLEESEGELRKSLEE ELFQVKMEREQHQTEIRDLQDQLSEMHDELDSTKRSEDREKGALIE NVEVLASRSNSSE

QSQAEADLREKVLKEENEKLQGRIAELERRAAQLQRQMEDVKGDEAQAKETLRKCE SEVQQLEEALVHARKEEKEATCARRALEKELEQAR RELSQVS

QEQKELLEKLRDEAEQKEQLRKLKNEMESERWHLDKTIEKLQKE MADIAEASRTSSLELQKQLGEYKEKNRRELAEMQTQLKEKCLEVEKARLAASKMQ

DE LRLKEEELQDYQRAEEEALTKRQLLEQSLKDLEYELEAKSHLKDDRSRLIKQME DKVSQLEIELEEERTNADLLSERITWSREQ MEQMRSELLQE

KAAKQDLECDKISLERQ NKDLKSRIIHLEGSYRSSKEGLVVQMEARIAELEDRLENEER RDRANLQLSNRRLERKVKELVMQVDDEHLSLTDQKDQ L

SLRLKAMKRQVEEAEEEIDRLESSKKKLQRELEEQMGVNEQLQGQLNSLKKGLR RLKTLSSKVLDDSDDDDLSSDAGSLYEAPLSYAFPKDSTIASQI
Transcript ENSMUST00000072899
Sequence
GGGGCTGGCGCGGCCTCCTGGCGACGCGGCGGCCGCTGCTCTCCGGCCCGGCTCTGCGGGCAGCTGCCGGAGCGGGACCCTGGAGGCAGAGGCG - UNI

13656 - - UNI32135 - CTGGGACAGAGAACCATGGAGCTGTATTTTGGCGAATACCAACACGTACAGCAGGAGTACGGGGTACACCTGAGACTTG

CCAGTGGTGACACTCCAAAGCCAAGGAATTCCCAGCCCTCAAAGGCAGGCTCCTATGGTGTCAGCATCAGGGTCCAGGGAATTGATGGCCACCCTTATAT

AGTCCTGAATAACACTGAGCGGTGTCTAGCAGGCACACCTTTCCCAGAAAACGCGCCATCGTTTCCATCTTCAGTGATAAATAACCTGTCCCTACATCCA

AGCAATGGAACCGTGTTGAAGGAGAACACTCCGGAGGAACTGCAGCTTCCAGAAAACCCGTACCTGCAAACCAGCCCGCTAAGAGGCCAGAAGCAGTTCT

CCCTCCACGAGGGCAGGAATGGAGTTCTAGAACGCAAAGACGGGCCCACGAAGCTGCCCCATGTGCTCAACTTCCAGAGGCACCCGGAGCTTCTGCAGCC

CTATGACCCAGAAAAGAATGAGGTGAACGCAAAGAAGCATCACCCTCCCGAGAGTCCCTGGCTGAGAAATGCAACAGAGGACGGGACCAACTGTAAGAAG

TCCCGGAACTGCTTCCCCAAATCCTACGGTTCCCAGCCCAACAGCCCTACTTCGGAAGATTTAGCCAAGACCAACATGACAGCGATCCGTCTCTGCAGCT

CTGTGGTCATAGAAGACCCCCAAAAGCAGACCTCAGTGTGCGTGAACGTTCAGAGGTGCGCCAAGGAGGGGGTGGGAGAGGAGACCCTTTCCCCTCGACG

GAAATCCCCAACTGCCCCCAGCCCACAGGCCTATTCTGAAACCAAGAAAAACAGGCCAGATGTGCTACCCTTCCGGCGACAAGATTCCGCAGGACCCATC

CTGGATGGAGCTCGGTCACGCAGGTCCTCTTCGTCATCCACGACTCCTACTTCTGCCACTTCCTTGTACAAATTTTTACTTGATGATCAGGAATGCGCCA

TTCATGCCGACAGCGTCAACCGCCATGAAAACAGAAGGTATATTCCCTTCTTGCCAGGAACTGGGCGGGATATCGACACCTGCTCAATTCCTGGTGTGGA

CCAGTTAATTGAAAAATTTGACCAAAAGCCTGGCCTTCAGAGAAGAGGAAGGTCTGGGAAGAGAAACAGGATCAATCCCGACGACAGGAAAAGATCCCGA

AGTGTAGATAGTGCCTTTCCATTTGGTCTCCAGGGAAACACAGAATACCTCACCGAGTTCAGCAGGAACCTGGGCAAGTCTAGCGAACACCTCCTTCGGC

CATCCCAGGTCTTCCCGCAGAGGTCAGTGGCCCAGGAGCACCGTGGGAAGCACAGTCCCAGCAGCCCGCCCGCAAAGCTGCAGGGCGCTCAAGGTGCCCA

CCCCAAGCCTCCCCTGCAGAACAAAGATGGGAAAGTTCTGAACAAAGGAAGGCAGGAAAGCACGGGGGCATGTGCCCCCTCCCTGCCAGCACCGAATAAA

AAAGAGGAAGAAATCAAAATAGCCACTGCCACGTTGATGTTACAGAACCGGGCGGTGGCTGCCACATCGGATTCTGGTGCCAAGAAAATTTCAGTGAAGA

CATTTCCTTCCGACTCCAGCACTCAG - UNI13656 - - UNI32135 - GCCACACCAGATCTCTTAAAGGGCCAGCAGGAGCTCACACAACAAAC

GAACGAGGAGACCGCCAAGCAGATCCTTTACAATTACCTCAAAGAAGG AGGCACAGACAATGAGGATGCCACCAAAAGGAAAGTGAACCTGGTCTTTGA

GAAAATCCAGACTTTGAAGTCCAGAGCAGCAGGGAGTGCCCAAGGAAGCAATCAA GCTCCGAATTCTCCCTCTGAAGGCAACAGTCTATTGGATCAGAA

GAACAAATTGATCCTAGAAGTGTCTGAACTACAGCAGCAACTGCAACTGGAGATGAAG AACCAACAGAACATCAAGGAGGAGCGAGAAAGAATGAGAGA

GGATTTAGAAGAGCTGCGAGTCCGGCACCAGAGCCAAGTGGAGGAGACGGCCACCCTGCAGAGACGGCTGGAGGAAAGTGAAGGCGAGCTGAGGAAGAGC

TTGGAAGA GCTGTTCCAAGTGAAGATGGAGCGTGAACAGCACCAGACTGAGATCAGAGACCTGCAGGACCAGCTGTCGGAAATGCATGATGAGCTAGAC

AGCACCAAGCGATCCGAGGACAGGGAGAAGGGAGCCCTGATTGAG GAGCTCCTGCAAGCCAAGCAGGACCTTCAAGATCTGCTCATTGCCAAAGAGGAA

CAGGAAGATCTCTTGAGGAAGCGGGAGCGGGAGCTGACTGCCTTGAAGGGCGCCTTGAAGGAGGAGGTTTCCAGCCATGACCAGGAGATGGATAAGCTGA

AGGAACAGTACGATGCTGAGCTGCAGGCCCTCAGGGAGAGTGTGGAGGAGGCAACCAAG AATGTTGAGGTCCTGGCCAGCAGGAGCAACTCCTCAGAGC

AGAGCCAGGCGGAGGCTGACCTGCGTGAGAAAGTGCTGAAGGAGGAGAATGAGAAGCTGCAGGGGAGGATTGCGGAGCTGGAGCGCAGGGCAGCCCAGCT

ACAGAGGCAGATGGAGGATGTGAAGGGTGACGAGGCCCAAGCAAAGGAGACACTCCGAAAGTGTGAG AGTGAAGTACAGCAGCTGGAGGAAGCCCTTGT

GCATGCCAGAAAGGAAGAAAAAGAAGCCACATGTGCCAGAAGGGCGCTGGAGAAGGAGCTGGAGCAAGCTCGG AGAGAGCTGAGCCAGGTCTCCCAGGA

GCAGAAGGAACTCCTGGAGAAACTCCGGGACGAGGCGGAGCAGAAGGAGCAGCTGCGAAAGCTGAAGAACGAGATGGAGAGCGAGCGGTGGCACCTGGAC

AAGACCATCGAGAAGCTGCAGAAGGAG ATGGCCGACATTGCTGAGGCCTCCCGCACATCCTCTTTGGAGCTGCAGAAGCAGCTGGGCGAGTATAAGGAG

AAGAACCGCCGGGAGCTTGCGGAAATGCAGACACAACTGAAGGAGAAATGCCTGGAAGTGGAAAAGGCCAGACTGGCAGCCTCGAAGATGCAGGATGAG 

TTACGCCTCAAGGAGGAAGAGTTGCAGGACTACCAGCGAGCTGAGGAGGAGGCGCTCACAAAACGGCAGCTTCTGGAGCAGTCGCTGAAGGACCTGGAGT

ATGAGCTGGAGGCCAAGAGCCACCTCAAGGATGACCGCAGCCGACTCATCAAGCAGATGGAG GACAAGGTGTCCCAATTGGAGATTGAATTGGAAGAAG

AAAGAACCAACGCTGACTTGCTGTCGGAGAGGATCACGTGGAGCAGGGAACAG ATGGAGCAGATGAGGAGCGAGCTTCTTCAGGAGAAAGCTGCCAAGC

AAGACTTAGAGTGTGACAAGATTTCCCTAGAGAGACAG AACAAAGACTTAAAGAGCCGGATTATCCACCTGGAAGGTTCCTACAGGTCCAGCAAGGAGG

GCCTGGTGGTGCAGATGGAGGCCAGGATTGCAGAGCTGGAGGACCGGCTGGAGAATGAGGAGAG GGATCGGGCCAACCTGCAGCTCAGCAACCGAAGGC

TGGAGCGGAAGGTGAAGGAGCTGGTGATGCAGGTGGATGATGAGCATCTGTCACTGACGGACCAGAAGGACCAG CTGAGCTTGCGCCTGAAAGCCATGA

AGCGCCAGGTGGAGGAGGCTGAAGAGGAGATCGACCGACTGGAAAGTTCTAAGAAGAAGCTGCAGAGGGAGCTGGAGGAGCAGATGGGGGTGAATGAGCA

GCTGCAGGGGCAGCTCAACTCTCTGAAGAAGGGCTTAAG GCTTAAGACACTGTCTAGTAAAGTACTGGACGACTCGGACGACGACGACCTCAGCAGTGA

TGCGGGAAGCCTCTACGAAGCCCCACTGAGCTATGCCTTTCCCAAAGACAGCACTATCGCCAGCCAGATCTGAGTCTGCTTCCAGGCCCGTTGATCCTGA

CAGGACTCTGCAGTCATCTAGACAGAGTAGGAGGCACTAAATAGAGCTTGTGAATGGAGTCAGACCCACGGTTACCACCTCACATTCCTCCTGGGGCCTC

TGCGTGGTTGAGTGACCTTGGATCTTAGATAGGGAGCTATTGAAGTTTCAGATGACCTAACTGGGACATTTGGGGGTAAGACAAAGCCCCATTGTGCACT

GCTGTCTGCCATCACTCCTTCTCCTGCCCCGGAGAAGGTTCCAGTGCCAGCTGTAATGATATAGGGACACATAGGGATGAAATGATGTATAGACTGAACC

AGACCTTCTCAAGGACCGCTGTTCTCCTTAAGGATGCTCCAGAGCCTTTCGAGTATGACATCTTTGTAAAGTTCACAAACTGATCTTGATTATCTTTTAA

AATATGAAGCTACCAGATCTCAAGTATTAAGAAGCTGGAGGCAAAGGAGGGAGAGTGAAGGCTATTCTGGAAACCAGAGGGGGTCAGACAGTGGGAATCA

ATAATTGGTTTGTATGGGAAACCAGCTCATTGATGGTTGGGGAAGGACACTTAGGCGGAGTCTGAGGCCTTGGTTGCTTATTTTATCTGAACCATGCAAA

GAGCAGTCCCTACTCCCCACTGCTTTCAAGCAAGCAGAATGGGAGACAGATGAGATTTTTAACAAGTGCTGTGCTTCCTAAAGGACAAGAGCGCTGTTGT

TGTGTCTCCTTGGCCCTTTTCCTCCATGGCAGACCTCCAAGCGAAGCTCGCTCAGGCCTGGAATTGGAGGAATAGGAGGGGCCTTGAGACGAGGCCTATG

GGCTTAGGTATGAGGCTAAGGAGGGAGGCATCCAGGAAGTTCATGGGGCAGGGGATGAGTAAGTGGGTATGGGGCTGATGTAAGAAGGAATACAGAGACG

TTCTTGAAAGCTGGGGGATGTGCAAGAAGGGCAGGGGGTGGGGGTTGAGCTGGAGTTTGGAATGATGGGAAAAGGGATTGGGAGTGCTTGCCATCTGAAG

GGCTGTTTTTGGGAACAGGTGTCAGGAAGGGGTGAGGTCCAAGGGCAAGCACATGATGCCAAGGTAGTTTTGGGAGGATGCTGGGCATCCCTGCATATCT

CCTGGCCTACCCATGTCTCCTCATGACTGTGACAGTCACCTATGAAAGAGCCTTGTGAGTTGCCTATGTGTAAGGCAGAGGTGACAGGACACTGGAGCAG

AGTCCTCAGGCTTCCTGATATGGGGACTCCTGGGGACCAGGTTACCATAAGGTCCTGTCCACAGCAGGTCAGAGTTCACACAGCTAGATTCAGAGAAGGG

ATCTGAAGGATGAGCATCTGCTGCCAGAGAACCAAGCCCTATTACACATCCCGAGATCCACTGTCTCCCTCGCCTGTCTCCTCACTGGGTATGGAGAGAC

TTCTGCTTTCAGCCATTCTTCCATGTAACAAGCATGTACTATCATCCATCAAAATGTGTCAGGCACAGACTTGGGCACTGGAAACACAGTAAATAGAAGT

AAAAATGTTGAGCCGGAAATGTAGCTCAGCTGGGGCAATGCGTGCCTAGCGTGCAGGAAGCCCTGTATTTAACCCCCAACTCTATAAACCGGGTGTGGTG

TGGTATGCCTGTGATCCCAACACAGGAAGTGGCAACAGGAGGATCCAGAGTTCAAAGTCAGCCTTGGATACATATGCAGGTCTTGGCCAAGCTGGGTTAT

ATAGGAGGCCCCGTCTCAAAAAAACCCAACCAACCCTGCCCTCCTGTAACCATCCAGGAGAGTGTGATGCAGCCTGAACCTCTCTATACTCAGCCTCGGA

GAACCTCTGTCCTCTTGGGAATGTGATGGCCTGCGATTGGTTGGCTGGTTCCCCAGAACACACAGGAATTCTTTAGCTCCTAGAATCTTCTCATGTCATC

ATTCGATATTTGTACTCAGCCTAGAAATGTCTCAGCCTGCTCATCCCAGAGATTCAGGTGACAAAAATCAAGACCCCGAGGAAGGGTGTTTGTTTTGTGG

TTTGACAAAAATTAGCCAGCCCTTATTCCAGTCAGTTCCTTCTGGTAGCCATGGGGCTAACTATATGAAGGAAGATAGCTCGTGGAAGGGAGAGCAGAGG

CCACCACTGGAAACACTTGTAGAGTCCCTCACCCCACCACACACACACACACCAGAGGAGGCTAAACGAGATGAGGGCATGTCTCCTGTGCTGTAATGGA

GTGGGCAGCGAGCCGGTGTGTGCAGTATAGTCAGTGAGTGACGCGACACTGGAATGAGGTTTAGAACGAGGTTTGTAAGTCCCAGCCTCATCTCTTCCCT

GTGATCCTGACAGGTGCATCCTGGGACAAGGTGGCGATTAGGACTCCAGGTCCTTCTCAGCTCGAATCTGTTGAGCATCCCTTGGTCTTCTTATATATAC

ATGTTTTTCTGTTTATTCCTTTAAGAACTAATCCTGCTCAAGAGCGTTTTCTTTAGCTAGCTTAAAAATATCTCCTGTAAAAACATACATGTTGCCAAGT

GCAATGTTGAGAAGACAATCACTGTATGGCTTTTATAAATTTGTTTTTCCTGCTCTGGAGTGTCATTCCACCATGACAGTTGGAATATTCTGGTGGGTCT

TTTAGTAGGGATTGGTTACTATGCGTTGTCATGGGGAAGAGACATTTTTTATCACAGCTACCTCCATGGGAATGACTTCATGGATAAAGCAAGGTTTCCT

TTCAATAAACTGTCACTTGACAGG
Translation
 - UNI13656 - - UNI32135 - MELYFGEYQHVQQEYGVHLRLASGDTPKPRNSQPSKAGSYGVSIRVQGIDGHPYIVLNNTERCLAGTPFPENA

PSFPSSVINNLSLHPSNGTVLKENTPEELQLPENPYLQTSPLRGQKQFSLHEGRNGVLERKDGPTKLPHVLNFQRHPELLQPYDPEKNEVNAKKHHPPES

PWLRNATEDGTNCKKSRNCFPKSYGSQPNSPTSEDLAKTNMTAIRLCSSVVIEDPQKQTSVCVNVQRCAKEGVGEETLSPRRKSPTAPSPQAYSETKKNR

PDVLPFRRQDSAGPILDGARSRRSSSSSTTPTSATSLYKFLLDDQECAIHADSVNRHENRRYIPFLPGTGRDIDTCSIPGVDQLIEKFDQKPGLQRRGRS

GKRNRINPDDRKRSRSVDSAFPFGLQGNTEYLTEFSRNLGKSSEHLLRPSQVFPQRSVAQEHRGKHSPSSPPAKLQGAQGAHPKPPLQNKDGKVLNKGRQ

ESTGACAPSLPAPNKKEEEIKIATATLMLQNRAVAATSDSGAKKISVKTFPSDSSTQ - UNI13656 - - UNI32135 - ATPDLLKGQQELTQQT

NEETAKQILYNYLKEG GGTDNEDATKRKVNLVFEKIQTLKSRAAGSAQGSNQ APNSPSEGNSLLDQKNKLILEVSELQQQLQLEMK NQQNIKEERER

MREDLEELRVRHQSQVEETATLQRRLEESEGELRKSLEE ELFQVKMEREQHQTEIRDLQDQLSEMHDELDSTKRSEDREKGALIE ELLQAKQDLQDLL

IAKEEQEDLLRKRERELTALKGALKEEVSSHDQEMDKLKEQYDAELQALRESVEEATK NVEVLASRSNSSEQSQAEADLREKVLKEENEKLQGRIAELE

RRAAQLQRQMEDVKGDEAQAKETLRKCE SEVQQLEEALVHARKEEKEATCARRALEKELEQAR RELSQVSQEQKELLEKLRDEAEQKEQLRKLKNEME

SERWHLDKTIEKLQKE MADIAEASRTSSLELQKQLGEYKEKNRRELAEMQTQLKEKCLEVEKARLAASKMQDE LRLKEEELQDYQRAEEEALTKRQLL

EQSLKDLEYELEAKSHLKDDRSRLIKQME DKVSQLEIELEEERTNADLLSERITWSREQ MEQMRSELLQEKAAKQDLECDKISLERQ NKDLKSRIIH

LEGSYRSSKEGLVVQMEARIAELEDRLENEER RDRANLQLSNRRLERKVKELVMQVDDEHLSLTDQKDQ LSLRLKAMKRQVEEAEEEIDRLESSKKKL

QRELEEQMGVNEQLQGQLNSLKKGLR RLKTLSSKVLDDSDDDDLSSDAGSLYEAPLSYAFPKDSTIASQI

For any suggestions or comments, please send an email to unitrap@crg.es