Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032238 (Rora)
Chromosomal location
Chr 9: 68501596 - 69227593 (+)
Description
RAR-related orphan receptor alpha Gene [Source:MGI (curated);Acc:Rora-001]
RefSeq_dna
NM_013646 
RefSeq_peptide
NP_038674.1 
UniGene
Mm.427266 Mm.470565 
MGI
MGI:104661 
Uniprot/SWISSPROT
P51448 
Uniprot/SPTREMBL
Q3U1P4 Q8BRL5 Q8C3F5 B1B189 
Human Ortholog
ENSG00000069667 (RORA)
Omim not available
UniTrap UNI35035
Vector Insertion
Chr 9: 68511995 - 69043881
Public Clones (sanger) IST10322C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29944
Vector Insertion
Chr 9: 69043912 - 69137698
Public Clones D184B06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38704
Vector Insertion
Chr 9: 69137856 - 69195938
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113624
Sequence
GCTCGGGATGGCTCTCGGCGGGCGGGCAGCTGCGGCAGCTGCTGCTGTGGCTCGGGCGGCGGCGGCAAGAGGGGGCTCCGGGGTCGGACGGTCGGCTCTC

CCTGCGCTCTCCGCACCGCGGCGTAAAGGATGTATTTTGTGATCGCAGCGATGAAAG CTCAAATTGAAATTATTCCATGCAAGATCTGTGGAGACAAAT

CGTCAGGAATCCATTATGGTGTCATTACGTGTGAAGGCTGCAAG GGCTTTTTCAGGAGAAGTCAGCAGAGCAATGCCACCTACTCCTGTCCTCGTCAGA

AGAACTGTTTGATTGATCGGACCAGCAGAAACCGCTGCCAGCATTGTCGGCTGCAGAAATGCCTGGCCGTGGGGATGTCTCGAGATG CTGTCAAGTTTG

GTCGGATGTCCAAGAAGCAGAGAGACAGCTTGTACGCCGAGGTGCAGAAGCACCGGATGCAGCAGCAGCAGCGAGACCACCAGCAGCAGCCTGGGGAGGC

GGAGCCGCTGACGCCCACCTACAACATCTCAGCCAATGGGCTGACGGAACTGCATGATGACCTCAGCACCTATATGGATGGGCACACCCCCGAGGGCAGC

AAGGCCGACTCAGCCGTCAGCAGCTTCTACCTGGACATCCAGCCCTCCCCAGACCAGTCGGGATTGGACATCAATGGGATCAAACCCGAACCCATATGTG

ACTACACACCAGCATCTGGCTTCTTCCCCTACTGTTCCTTCACCAACGGAGAGACTTCCCCAACCGTGTCCATGGCAGAACTAG AACACCTTGCCCAGA

ACATATCCAAATCCCACCTGGAAACCTGCCAGTACTTGCGGGAAGAGCTCCAGCAGATAACGTGGCAGACCTTCCTGCAGGAGGAGATTGAAAACTACCA

GAACAAG CAGAGAGAGGTGATGTGGCAGCTGTGTGCCATCAAGATTACAGAAGCTATCCAGTATGTGGTGGAGTTTGCCAAACGCATTGATGGATTTAT

GGAGCTGTGTCAAAATGATCAAATTGTGCTTCTAAAAGCAG GCTCGCTAGAGGTGGTGTTTATTAGGATGTGCCGTGCCTTTGACTCTCAGAACAACAC

CGTGTACTTTGACGGGAAGTATGCGAGCCCCGATGTCTTCAAGTCCCTAG GTTGTGAAGACTTCATCAGCTTTGTGTTTGAATTTGGGAAGAGTTTGTG

TTCTATGCACCTGACCGAAGACGAAATCGCGTTATTTTCTGCATTCGTACTGATGTCAGCGG ATCGCTCGTGGCTTCAGGAAAAGGTAAAAATAGAAAA

GCTGCAACAGAAAATTCAGCTGGCCCTTCAGCACGTCCTACAGAAGAACCACCGAGAAGATGGAATTCTAACCAAG CTAATATGCAAGGTGTCTACGTT

AAGAGCCCTATGTGGACGACATACGGAAAAGCTAATGGCATTTAAAGCAATATACCCAGACATTGTGCGACTCCATTTTCCTCCATTATACAAGGAATTG

TTCACTTCAGAATTTGAGCCAGCCATGCAAATCGATGGGTAAATGTCGCGCCCGAGCACTTCTAGAACATCTGGAGTACAAACATGAAAGTAAGAGAGAA

AATTTTTAAAAAGGAAATGAAACAATAACAACGAAGACAAATTTAACTGAGACACTTTCTATGGCCCTGCACAGCCCTGGAGCGCCAACAACACTGCACA

GACATCTTGTGGTGAACGGGGTTCAGGCACAAAGGGGAAACAATCCAACCCAATCAAAGCTGAACTTGTTTTGCTCATGCATATGATTTCCACTATGCCT

ACAGATATGGACCCTTTTTCTGTCTCAACTTCTAGAGCGGTTGACCTCGGCATATGACAGGAGGGTACTACAGTCAGAGGAGTCCCCTTCTCGTAGCTCA

CTGCCCACAGACTCTTACGGGTAACAGCAGAGTCCAGCGTTAATCGGTGACCCCGGTGTGTATGGCGGGAGTTGCGGCGTTACTTTGCACAGCTTGCTTT

TCTGTGTCATGAAGGAAGATTTTGGTTTCTCTCACCGATTATTGCCGGTCAGCAGGATGGCGTGAAAAGGGGATCCATAGCGCTCGCAACAATAGCATTA

TAATATATTACACAGGGTAAATGGGCATGAAGACTATATATAGCTAAAGAGATATTGTTTATATATTGTTTTAATTAATATAAAATGTAGTGACTGGCGT

AGCTTTTCCTGTTGAATTGATAAGGCACTTTCCGTTTTTGCACCTTTTTGTTTCCTTTAAATTAAATGCTAGCGTGTTCACTGTCGCCGTGTCGCATGTA

CACCAGAAACACAAGTTTAGCTGAGAAGGCTTGGAAGGTACGTTGGGAGGTATTTATGCTGCTGTTT
Translation
MYFVIAAMKA AQIEIIPCKICGDKSSGIHYGVITCEGCK GFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDA AVKFGRMSKK

QRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSTYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPAS

GFFPYCSFTNGETSPTVSMAELE EHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNK QREVMWQLCAIKITEAIQYVVEFAKRIDGFMELC

QNDQIVLLKAG GSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLG GCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSAD DRSWLQEKVKI

EKLQQKIQLALQHVLQKNHREDGILTK LICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Transcript ENSMUST00000064920
Sequence
TACATTGGGAAAAAAAACATGGAGTCAGCTCCGGCAGCCCCCGACCCCGCCGCCAGCGAACCGGGCAGCAGCGGCTCGGAGGCGGCCGCGGGCTCCAGGG

AGACCCCGCTGACCCAGGACACGGGCCGCAAGAGCGAGGCACCGGGCGCGGGGCGCAGGCAGAGCTATGCGAGCTCCAGCCGAG GTGACTTTATAATCT

CTAGGCACCGACATGTCTCGCTGAAGTCAAGGAAGGAGAACTCACAAGCTAAA TTTTAGAGAAACCTGAAGAACTGGACAAAGACGGAGGAAAGGCAGC

CAGATGTGATCCTCAACTTGCAGAAGCGGAGAGCCTCTCTCATCCCTTAGGAACCATGGTAGTCACGGATAGGAATGAGCAGGTGAAAACCGAGCGGATC

CTGAAACACCCAGTCTCAGGGGAACCACGTATGCTTATCAGGCCTCAAACCTCTTAAATAAACTGCATCTCTTTCCATTTTTAGTTTTCAGTCAGGAAAC

CAGTGGATGATGAAAAGGCCCTGATATAGTCTGTGCTCCACGGGGGCATCCACATGCCAATGATATTCTCTCTAAAAGGGCAGGGCAGCTGGGAGGGTGA

ACTGCCCGTAACTCTCAATTGCCCAGGTAACGAAGTATGGA
Translation
MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSYASSSRG GDFIISRHRHVSLKSRKENSQAK F
Transcript ENSMUST00000034766
Sequence
ATGGAGTCAGCTCCGGCAGCCCCCGACCCCGCCGCCAGCGAACCGGGCAGCAGCGGCTCGGAGGCGGCCGCGGGCTCCAGGGAGACCCCGCTGACCCAGG

ACACGGGCCGCAAGAGCGAGGCACCGGGCGCGGGGCGCAGGCAGAGCTATGCGAGCTCCAGCCGAG - UNI35035 - GTATCTCAGTCACGAAGAAG

ACACACACAT - UNI29944 - CTCAAATTGAAATTATTCCATGCAAGATCTGTGGAGACAAATCGTCAGGAATCCATTATGGTGTCATTACGTGTGA

AGGCTGCAAG GGCTTTTTCAGGAGAAGTCAGCAGAGCAATGCCACCTACTCCTGTCCTCGTCAGAAGAACTGTTTGATTGATCGGACCAGCAGAAACCG

CTGCCAGCATTGTCGGCTGCAGAAATGCCTGGCCGTGGGGATGTCTCGAGATG CTGTCAAGTTTGGTCGGATGTCCAAGAAGCAGAGAGACAGCTTGTA

CGCCGAGGTGCAGAAGCACCGGATGCAGCAGCAGCAGCGAGACCACCAGCAGCAGCCTGGGGAGGCGGAGCCGCTGACGCCCACCTACAACATCTCAGCC

AATGGGCTGACGGAACTGCATGATGACCTCAGCACCTATATGGATGGGCACACCCCCGAGGGCAGCAAGGCCGACTCAGCCGTCAGCAGCTTCTACCTGG

ACATCCAGCCCTCCCCAGACCAGTCGGGATTGGACATCAATGGGATCAAACCCGAACCCATATGTGACTACACACCAGCATCTGGCTTCTTCCCCTACTG

TTCCTTCACCAACGGAGAGACTTCCCCAACCGTGTCCATGGCAGAACTAG AACACCTTGCCCAGAACATATCCAAATCCCACCTGGAAACCTGCCAGTA

CTTGCGGGAAGAGCTCCAGCAGATAACGTGGCAGACCTTCCTGCAGGAGGAGATTGAAAACTACCAGAACAAG CAGAGAGAGGTGATGTGGCAGCTGTG

TGCCATCAAGATTACAGAAGCTATCCAGTATGTGGTGGAGTTTGCCAAACGCATTGATGGATTTATGGAGCTGTGTCAAAATGATCAAATTGTGCTTCTA

AAAGCAG GCTCGCTAGAGGTGGTGTTTATTAGGATGTGCCGTGCCTTTGACTCTCAGAACAACACCGTGTACTTTGACGGGAAGTATGCGAGCCCCGAT

GTCTTCAAGTCCCTAG GTTGTGAAGACTTCATCAGCTTTGTGTTTGAATTTGGGAAGAGTTTGTGTTCTATGCACCTGACCGAAGACGAAATCGCGTTA

TTTTCTGCATTCGTACTGATGTCAGCGG ATCGCTCGTGGCTTCAGGAAAAGGTAAAAATAGAAAAGCTGCAACAGAAAATTCAGCTGGCCCTTCAGCAC

GTCCTACAGAAGAACCACCGAGAAGATGGAATTCTAACCAAG CTAATATGCAAGGTGTCTACGTTAAGAGCCCTATGTGGACGACATACGGAAAAGCTA

ATGGCATTTAAAGCAATATACCCAGACATTGTGCGACTCCATTTTCCTCCATTATACAAGGAATTGTTCACTTCAGAATTTGAGCCAGCCATGCAAATCG

ATGGGTAAATGTCGCGCCCGAGCACTTCTAGAACATCTGGAGTACAAACATGAAAGTAAGAGAGAAAATTTTT
Translation
MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSYASSSRG - UNI35035 - GISVTKKTHTS - UNI29944 - SQIEI

IPCKICGDKSSGIHYGVITCEGCK GFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDA AVKFGRMSKKQRDSLYAEVQKHRMQQ

QQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSTYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPT

VSMAELE EHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNK QREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAG GSLE

VVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLG GCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSAD DRSWLQEKVKIEKLQQKIQLALQHVLQ

KNHREDGILTK LICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG

For any suggestions or comments, please send an email to unitrap@crg.es