Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032243 (Itga11)
Chromosomal location
Chr 9: 62525668 - 62631755 (+)
Description
integrin alpha 11 Gene [Source:MGI Symbol;Acc:MGI:2442114]
RefSeq_dna
NM_176922 
RefSeq_peptide
NP_795896.3 
UniGene
Mm.34883 
MGI
MGI:2442114 
Uniprot/SWISSPROT
P61622 
Uniprot/SPTREMBL
Q7TQC3 Q8CE84 
Human Ortholog
ENSG00000137809 (ITGA11)
Omim not available
UniTrap UNI34930
Vector Insertion
Chr 9: 62544803 - 62575412
Public Clones IST14339G2 (tigm) IST11184C5 (tigm) IST13755G11 (tigm) IST13066B12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33681
Vector Insertion
Chr 9: 62622192 - 62624419
Public Clones IST14424H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034774
Sequence
GGCTCAGGACGCTCGCGAACCGAGGCTGTGGCTCTGGCTCTCAGCCGCGCGACCATCGCGACACCCGCCGCCGCGCAGCGGGCCATGGACTTTCCCAGGG

GCCTCCTGGTGGCCTGGACCCTCAGCCTTTGGCCAG GATTCACGGACACCTTCAATATGGATACCAGAAATCCCCGGGTCATTGCTGGTCCCAGTGCTG

CCTTCTTTGGCTACACAGTACAGCAGCATGATATCAGTGGCAAGAAGTG - UNI34930 - GTTGGTTGTGGGTGCCCCAATGGAAACCAATGGCCAT

CAGAAGACAGGAGACGTATACAAATGTCCGGTAACCCAGGGCAACTGCACCAAGCTCAACCTGG GCAGGGTCACTCTGTCCAATGTGTCTGAGAGGAAG

GACAACATGCGCCTCGGCCTGAGCCTTGCCACCAACCCCAAGGACAACAGCTTCCTG GCCTGCAGCCCTCTCTGGTCGCACGAGTGTGGAAGCTCCTAC

TACACCACTGGCATGTGCTCACGGGTCAACTCCAACTTCAGATTCTCTAAGACGGTAGCTCCGGCACTTCAGA GGTGCCAGACTTACATGGACATCGTC

ATTGTCTTAGATGGCTCCAACAGCATCTACCCCTGGGTGGAGGTCCAACACTTCCTCATCAATATCCTCAAAAAGTTCTACATTGGCCCCGGCCAGATCC

AG GTCGGAATAGTCCAGTATGGAGAAGATGCCGTCCATGAGTTCCACCTTAATGACTACAGGTCTGTAAAAGATGTGGTGGAAGCCGCCAGCCACATTG

AGCAGAGAGGAGGGACAGAGACCCGCACGGCATTTGGCATTGAATTTGCACG CTCGGAGGCTTTCCAGAAGGGTGGAAGAAAAGGGGCCAAGAAAGTGA

TGATTGTCATCACGGACGGGGAATCCCACGACAGCCCAGACCTGGAGAAGGTGATCCGGCAGAGCGAGAAGGACAACGTGACCAGATACGCTGTGGCC G

TTTTGGGCTACTACAACCGCAGGGGGATCAATCCAGAGACTTTTCTAAATGAAATCAAATACATCGCCAGCGACCCTGACGACAAGCACTTCTTCAACGT

CACAGATGAGGCGGCCCTGAAGGACATTGTTGATGCCCTTGGGGACAGGATCTTCAGCTTGGAAG GCACCAACAAGAATGAGACCTCTTTTGGGCTGGA

GATGTCGCAGACTGGCTTTTCTTCACATGTGGTAGAG GATGGGATCCTGCTGGGAGCTGTGGGAGCCTATGACTGGAACGGGGCGGTGCTGAAGGAGAC

AAGTGCTGGCAAGGTGATTCCTCACCGAGAGTCCTACCTTAAGGAGTTTCCAGAGGAGCTGAAGAACCATGCAGCATACCTAG GGTACACGGTGACGTC

GGTTGTGTCCTCCAGGCAGGGGCGGGTGTATGTGGCTGGAGCCCCCAGATTCAACCATACTGGCAAGGTCATTCTATTCAGCATGCACAACAACCGGAGC

CTCACCATCCACCAGGCTCTTCGGGGCGAGCAG ATAGGCTCCTACTTTGGGAGTGAGATTACCTCAGTGGACGTCAATGATGACAGAGTGACAGATGTG

CTGCTGGTGGGTGCACCCATGTACTTCAGCGAGGGCCGAGAGCGAGGCAAGGTGTATGTCTACAACCTGAGACAG AACCGGTTTGTTTATAATGGCACT

CTGAAGGATTCCCACAGCTACCAGAACGCCCGGTTCGGGTCCTGCATCGCCTCTGTTCAAGACCTCAACCAAGATTCCTACAATGATGTGGTGGTGGGGG

CCCCTCTGGAGGACAGCCACAGAGGGGCCATCTACATCTTCCATGGCTTCCAAACCAATATCCTGAAGAAGCCCATGCAG AGAATAACAGCCTCGGAGC

TGGCTCCTGGCCTGCAGCATTTTGGCTGCAGCATCCACGGACAACTGGACCTCAATGAGGATGGGCTTGTGGACCTAGCAGTGGGCGCCCTGGGCAACGC

TGTGGTTTTGTG GGCCCGCCCTGTAGTTCAAATCAACGCCAGCCTCCACTTTGAGCCTTCCAAGATCAACATCTTCCACAAGGACTGCAAGCGCAATGG

CAGGGATGCCACCTGCCTGGCCGCCTTCCTCTGCTTCATACCCATCTTCCTGGCACCCCACTTCCAAACAGCAACCGTCG GCATCAGGTACAATGCAAC

CATGGATGAGAGGCGGTATATGCCGCGGGCACATCTGGACGAGGGCGGAGACCAGTTCACCAACAGAGCCGTCCTGCTCTCCTCTGGCCAGGAACACTGT

CAAAGGATCAACTTCCATGTCCTG GACACTGCAGACTACGTGAAGCCAGTGGCCTTCTCCGTGGAGTACTCCCTAGAGGACCCTGACAACGGCCCCATG

CTGGACAACGGCTGGCCCACTACGCTCAGAGTGTCG GTGCCCTTCTGGAATGGCTGTAATGAGGATGAACACTGTGTCCCTGACCTTGTACTGGATGCT

CGGAGTGACCTGCCCACTGCCAT GGAGTACTGCCAGCGGGTGCTGGGGAGGCCGGCGCAGGACTGCTCCAGCTACACCCTGTCCTTCGACACCACTGTC

TTCATCATAGAGAGCACGCGCCGCCGGGTGGCAGTGGAGGCCACGCTGGAGAACAGAGGAGAGAATGCTTACAGCGCCGTCCTCAACATCTCCCAGTCAG

AGAACCTTCAGTTTGCCAGCCTGATCCAGAAG GATGACTCAGACAACAGCATCGAGTGTGTGAACGAGGAGAGGCGGCTTCACAAGAAAGTCTGCAACG

TCAGCTACCCCTTCTTCAGAGCCAAGGCCAAG GTGGCTTTCCGTCTGGATTTCGAGTTCAGCAAGTCTGTGTTTCTGCACCATCTTCAGATCCATCTGG

GTGCCGGCAG TGACAGTCACGAGCAAGACAGCACCGCAGACGATAACACGGCCCTCCTGCGCTTCCACCTCAAATATGAAGCAGACGTCCTCTTTACCA

G AAGCAGCAGCCTGAGCCACTTCGAGGTCAAGGCAAACAGCTCACTTGAGAGCTATGATGGCATCGGACCTCCGTTCAACTGTGTTTTCAAG GTGCAG

AACCTGGGCTTTTTCCCCATCCACGGGGTGATGATGAAGATCACTGTGCCCATCGCCACCAGGGGTGGCAACCGCCTGCTGATGTTGAGGGACTTCTTCA

CCGACCAG GGCAACACATCCTGTAACATCTGGGGGAACAGCACAGAGTACAGGAGTACCCCAACTGAGGAAGATCTGAGCCATGCCCCACAGAGG - U

NI33681 - AATCACAGCAACTCCGACGTGGTCTCCATCATCTGCAACCTGAGGCTGGCCCCCAGCCAGGAGACCAGCTTCTACCTGGTGGGAAACCTG

TGGCTGACATCTCTGAAAGCA CTCAAGTACAGGTCTCTGAAGATCACAGTCAACGCCGCCTTGCAGAGGCAGTTCCACAGCCCCTTCATCTTCCGAGAG

GAAGACCCTAGCCGCCAG GTCACATTTGAGATCTCCAAGCAAGAAGACTGGCAGGTCCCCATCTGGATCATCGTGGGCAGCACTCTGGGGGGCCTCTTG

CTGCTGGCCCTGCTGGTCCTGGCACTGTGGAAG CTCGGTTTTTTTAAAAGTGCCAAGCGCAAGAGGGAACCTGGCCTAGGCCCCATCCCCAAAGAGCTC

AAGTGAGGATCCAGAGGAAGCTTCAAGTTGTTGGGGGCCCGACACCAGTCCGGGGGTGTGCAGGCCCGGGCTATGGCCTCAGAGCTGGAGCAAAGAGGAC

ACCCATGGACTTTACATTGAGTTCATCTCTGGAGCAATGGCAACTGATCGCTGTGGGATGGACCTCCAGCCCGTGTTCGGAGTGACTTCTCTACTAGAGG

CCAAGACCTCCAGTACAGATCCCTAAGGACTAAAAGGGACCCTCCAAGACCCACCGGTGGCCTTCCCCCAAGGCTCTGTGGAGGGAATCTGCTGCCCCAA

ACACTAAGGTGCTAGGGTTTTGTTGTCTTGCCCACCTCTGAAGAAACTCAAGGGGAAGCTAGCAAATACGAGCCCACTGTGCACGCCCTATCTGGACCTA

TAGCTTCAGGACTCCATGGCCCGGGAGCATAACCTCCGCCGCACCCCTTACCCTTGCTCTTGGTTCCCAAACCACAGCCATCCCTTCTCCACAGATAGAC

CCCAAAGATCTCTATGAGTGACCCAGAGTTGTGTGGCTTGATATGCCAGCTGCAGGCCAGTGATGGAAACACATCCAGGGACTGTGCCAAATGAACTGGA

GGGAATCAGGATGCTGGGTACCTTCCAAACATCAGAAAGCAGCAGGGCTCTCCAGCAGTAACCACCACCCACTCAATCCTGCTCTCCAGCCTCCCCCGCA

GCTCCTCTCAGCCGCTTTGGTTGCTAGGCAACTCGTGCTAGGGAGCCTGAGGAGGATGATAAAAATCCGTGGCTCTCCGTACCCTCTTGTCTGACAACTG

CAGCTTGTCCCTGGTAGATGCACTGTGATAGGGAGCCTCTGTTTCTTACATCAGCACCTACACACACACACACACACACACACACACACACACACACACA

CACACACACGCACGCACCTCCCAACCATCAGCGTGTGGGAGAAGGGCTCCTGTAGGGGGCGCTGTGGGGGGCCTTCTAGGCATGCACTGAACAAAGCCCA

TGCAAGGCCCCTGGGAACCTTAAACCTCAGAGGCAGATAGGCATCTCGCCGGCCAGCTCTGGGATAAGCCCCAAGGACAAGGGGCATGCCGGATGCCCAG

CAGAGTAATTTATGCCTTAACCTTTTGTTGAGATGGAAATGGACACATCAGTGTCCCCTGTCATCTGTTTCATCTGAACAATGTCATCTGTTCCCCTATG

CGGTACGACCTTTACTGTCAGAAATATATTTAAGAAAATGTTCTAAACGGTATTT
Translation
MDFPRGLLVAWTLSLWPG GFTDTFNMDTRNPRVIAGPSAAFFGYTVQQHDISGKKW - UNI34930 - WLVVGAPMETNGHQKTGDVYKCPVTQGNC

TKLNLG GRVTLSNVSERKDNMRLGLSLATNPKDNSFL ACSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQR RCQTYMDIVIVLDGSNSIYPW

VEVQHFLINILKKFYIGPGQIQ VGIVQYGEDAVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFAR RSEAFQKGGRKGAKKVMIVITDGESH

DSPDLEKVIRQSEKDNVTRYAVA VLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEG GTNKNETSFGLEMSQTGFS

SHVVE DGILLGAVGAYDWNGAVLKETSAGKVIPHRESYLKEFPEELKNHAAYLG GYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFSMHNNRSLTIHQ

ALRGEQ IGSYFGSEITSVDVNDDRVTDVLLVGAPMYFSEGRERGKVYVYNLRQ NRFVYNGTLKDSHSYQNARFGSCIASVQDLNQDSYNDVVVGAPLE

DSHRGAIYIFHGFQTNILKKPMQ RITASELAPGLQHFGCSIHGQLDLNEDGLVDLAVGALGNAVVLW WARPVVQINASLHFEPSKINIFHKDCKRNGR

DATCLAAFLCFIPIFLAPHFQTATVG GIRYNATMDERRYMPRAHLDEGGDQFTNRAVLLSSGQEHCQRINFHVL DTADYVKPVAFSVEYSLEDPDNGP

MLDNGWPTTLRVS VPFWNGCNEDEHCVPDLVLDARSDLPTAM MEYCQRVLGRPAQDCSSYTLSFDTTVFIIESTRRRVAVEATLENRGENAYSAVLNI

SQSENLQFASLIQK DDSDNSIECVNEERRLHKKVCNVSYPFFRAKAK VAFRLDFEFSKSVFLHHLQIHLGAGS SDSHEQDSTADDNTALLRFHLKYE

ADVLFTR RSSSLSHFEVKANSSLESYDGIGPPFNCVFK VQNLGFFPIHGVMMKITVPIATRGGNRLLMLRDFFTDQ GNTSCNIWGNSTEYRSTPTEE

DLSHAPQR - UNI33681 - NHSNSDVVSIICNLRLAPSQETSFYLVGNLWLTSLKA LKYRSLKITVNAALQRQFHSPFIFREEDPSRQ VTFEISK

QEDWQVPIWIIVGSTLGGLLLLALLVLALWK LGFFKSAKRKREPGLGPIPKELK

For any suggestions or comments, please send an email to unitrap@crg.es