Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032249 (Anp32a)
Chromosomal location
Chr 9: 62189189 - 62225698 (+)
Description
acidic (leucine-rich) nuclear phosphoprotein 32 family, pseudogene Pseudogene [Source:MGI Symbol;Acc:MGI:3525200]
RefSeq_dna
NM_009672 
RefSeq_peptide
NP_033802.2 
UniGene
Mm.269088 
MGI
MGI:108447 MGI:3525200 
Uniprot/SWISSPROT
O35381 Q64G17 
Human Ortholog
ENSG00000139223 (ANP32D)
Omim not available
UniTrap UNI4660
Vector Insertion
Chr 9: 62189362 - 62219526
Public Clones (sanger) AM0762 (sanger) P005C01 (ggtc) 3SD051D06 (ggtc) W256D05 (ggtc)
W255E01 (ggtc) 5SD051D06 (ggtc) CMHD-GT_298B8-3 (cmhd) IST14124E11 (tigm)
IST12693A7 (tigm) IST14388G9 (tigm) IST10760D6 (tigm)
Private Clones OST456299 (lexicon) OST452670 (lexicon) OST447353 (lexicon) OST430714 (lexicon)
OST425506 (lexicon) OST421910 (lexicon) OST417016 (lexicon) OST413951 (lexicon)
OST402147 (lexicon) OST391110 (lexicon) OST360988 (lexicon) OST353130 (lexicon)
OST334503 (lexicon) OST328770 (lexicon) OST319150 (lexicon) OST308728 (lexicon)
OST288817 (lexicon) OST282008 (lexicon) OST273907 (lexicon) OST253762 (lexicon)
OST226428 (lexicon) OST220249 (lexicon) OST214421 (lexicon) OST189068 (lexicon)
OST175809 (lexicon) OST173840 (lexicon) OST147591 (lexicon) OST144937 (lexicon)
OST132537 (lexicon) OST125889 (lexicon) OST124882 (lexicon) OST116986 (lexicon)
OST111844 (lexicon) OST106870 (lexicon) OST77437 (lexicon) OST68624 (lexicon)
OST46367 (lexicon) OST43142 (lexicon) OST34432 (lexicon) OST34012 (lexicon)
OST1613 (lexicon) OST1139 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18614
Vector Insertion
Chr 9: 62219677 - 62219868
Public Clones not available
Private Clones OST419669 (lexicon) OST232591 (lexicon) OST215510 (lexicon) OST200800 (lexicon)
OST185976 (lexicon) OST112153 (lexicon) OST215 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24090
Vector Insertion
Chr 9: 62219992 - 62221291
Public Clones not available
Private Clones OST235311 (lexicon) OST105511 (lexicon) OST18733 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085519
Sequence
GAGAACCGAGCGGAGCTGGTTGAGCCTTCAAAGTCCTAAAACGCGCGGCCGTGGGTTCGGGGTTTATTGATTGAATTCCGCTGGCGCAGGATCCTCTGCA

GAAAGAGAGAGCGCGAGAGATGGAGATGGACAAACGGATTTATTTAGAGCTGCGGAACAGGACGCCCTCTGAT - UNI4660 - GTGAAAGAGCTGGT

CCTGGATAACTGTAAGTCAATTGAAGGCAAAATCGAAGGCCTCACGGATGAGTTTGAAGAACTGGAATTCCTAAGTACAATCAACGTAGGCCTCACCTCC

ATTTCCAACTTACCAAAGTTAAACAAACTCAAGAAG - UNI18614 - CTTGAATTAAGCGAAAACAGAATCTCAGGGGACCTGGAAGTATTGGCAGA

GAAATGTCCGAACCTTAAGCATCTAAATTTAAGTGGCAACAAAATAAAAGATCTCAGCACAATAGAGCCGCTG - UNI24090 - AAGAAGTTAGAGA

ATCTCAAGAGCCTAGACCTGTTTAACTGTGAGGTGACCAACCTGAATGCCTACCGAGAAAACGTGTTCAAGCTCCTGCCCCAGGTCATGTACCTCGATGG

CTATGACAGGGACAACAAGGAGGCCCCCGACTCCGATGTTGAGGGCTACGTGGAGGATGACGACGAGGAAGATGAGGATG AGGAGGAGTATGATGAATA

TGCCCAGCTAGTGGAAGATGAAGAGGAAGAGGATGAGGAGGAAGAAGGGGAGGAAGAGGATGTGAGTGGAGAGGAGGAG GAGGATGAGGAAGGTTACAA

TGACGGGGAAGTGGATGACGAGGAAGACGAAGAAGAAGCTGGTG AAGAAGAAGGGAGTCAGAAGCGAAAACGAGAACCGGACGATGAGGGCGAAGAGGA

TGACTAAGGAATGAACCTGTTTGGGGAAATTCCTATTGTGATTTGACTGTTTTTACCCATATCCCCTCCCCCTCCTATTCCTGCCCCCCGAAACTTATTT

TTTTCTGATTGTAGCATTGCTGTGGGAAGGAGAGGGGAAAAGTGTACTGGGGGTTGATGGGGGGTGGGGGTGGGGGGGAGGGGAGGAATAAAATACTATT

TTTACTGCCACACTTTATTTCCCCCCCTCCTTTTTCCTTGTGTCTGGTTTTGTCCCCATAAATGCAATAGCTTAGTGCACACC
Translation
MEMDKRIYLELRNRTPSD - UNI4660 - VKELVLDNCKSIEGKIEGLTDEFEELEFLSTINVGLTSISNLPKLNKLKK - UNI18614 - LELSE

NRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPL - UNI24090 - KKLENLKSLDLFNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSD

VEGYVEDDDEEDEDE EEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEE EDEEGYNDGEVDDEEDEEEAGE EEEGSQKRKREPDDEGEEDD

For any suggestions or comments, please send an email to unitrap@crg.es