Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032253 (Phip)
Chromosomal location
Chr 9: 82759766 - 82869096 (-)
Description
pleckstrin homology domain interacting protein Gene [Source:MGI Symbol;Acc:MGI:1932404]
RefSeq_dna
NM_001081216 
RefSeq_peptide
NP_001074685.1 
UniGene
Mm.221688 Mm.409555 
MGI
MGI:1932404 
Uniprot/SWISSPROT
Q8VDD9 
Uniprot/SPTREMBL
Q05CQ5 Q32NY1 Q3UW86 Q8BRF9 Q8BSJ8 
Human Ortholog
ENSG00000146247 (PHIP)
Omim not available
UniTrap UNI25460
Vector Insertion
Chr 9: 82868341 - 82868533
Public Clones not available
Private Clones OST183062 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7138
Vector Insertion
Chr 9: 82853459 - 82868280
Public Clones RRJ571 (baygenomics) IST10906E2 (tigm)
Private Clones OST205297 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9368
Vector Insertion
Chr 9: 82839526 - 82853118
Public Clones XH239 (baygenomics) XE488 (baygenomics)
Private Clones OST431235 (lexicon) OST407487 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2795
Vector Insertion
Chr 9: 82826675 - 82839364
Public Clones AH0312 (sanger) RRF077 (baygenomics) D083D09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1408
Vector Insertion
Chr 9: 82809032 - 82820003
Public Clones CH0765 (sanger) RRF085 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7196
Vector Insertion
Chr 9: 82787949 - 82789628
Public Clones RRU497 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11835
Vector Insertion
Chr 9: 82784080 - 82786929
Public Clones A007E01 (ggtc) A064F08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8366
Vector Insertion
Chr 9: 82781277 - 82783720
Public Clones XG282 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12250
Vector Insertion
Chr 9: 82765469 - 82768896
Public Clones A046E06 (ggtc)
Private Clones OST58755 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034787
Sequence
GGCGGCCGCAGCCGGGGCCGCTGCCTGAGAGTTGTTGTTTCCTCCTCCTCCTCCGCCTCCGCCGCCGTTGCTTGAATGGTGGAGCCGAGGCTCGGCTCGT

GAGCACACACTGACAGCTACAGGGCAGGCGGCGGCACCGTCCCCGCGTCCCCTCGGCGGCGGGGTGTCCCGCCGGCGGCCCCGAAGTGACCCGCAAACAT

GTCTCGTGAGAGGAAAGGCCTCTCGGAGCTGCGATCGG AGCTCTACTTCCTCATCGCCCGGTTCCTGGAAGATGGACCCTGTCAGCAGGCGGCTCAG G

TGCTGATCCGCGAAGTGGCCGAGAAGGAG - UNI25460 - CTGCTGCCCCGGCGCACCGACTGGACCGGGAAGGAGCACCCCAGGACCTACCAGAAT

CTG - UNI7138 - GTGAAGTATTATAGACACCTTGCACCTGATCACTTGCTGCAAATATGTCATCGGCTAGGACCTCTTCTTGAGCAAGAAATTCCT

CAGAGTGTTCCTGGAGTACAGACTTTACTAGGAGCTGGAAGACAGTCCTTGCTACGAACAAATAAAA GCTGCAAGCATGTGGTATGGAAAGGATCTGCC

CTGGCTGCACTGCACTGTGGGAGGCCGCCAGAGTCTCCAGTTAACTACGGTAGCCCACCTAGCATTG - UNI9368 - CGGATACTCTGTTTTCAAGG

AAGCTGAATGGGAAATACAGACTTGAACGACTTGTTCCAACTGCAGTTTATCAGCACATGAAGATGCATAAGCGAATTCTTGGACACTTATCATCGGTGT

ACTGTGTAACTTTTGATCGAACTGGCAGGCGGATATTTACT - UNI2795 - GGTTCTGATGATTGTCTTGTGAAAATCTGGGCCACAGACGATGGAA

GATTGCTAGCTACTTTAAGAGGACATGCTGCTGAAATATCAGACATGGCTGTAAACTATGAGAATACTATGATAGCAGCTGGAAGTTGTGATAAAATGAT

TCGTGTCTGGTGTCTTCGAACCTGTGCACCTTTGGCTGTTCTTCAGGGACATAGTGCATCTATTACATCACTACAG TTCTCACCATTGTGCAGTGGCTC

AAAGAGATACCTGTCTTCTACAGGGGCGGACGGCACTATTTGCTTTTGGCTTTGGGATGCTGGAACCCTTAAAATAAA TCCAAGACCCACAAAATTTAC

AGAGCGTCCTCGGCCTGGAGTGCAAATGATATGTTCTTCGTTCAGTGCTG GTGGGATGTTTTTGGCCACTGGAAGCACTGACCATATTATTAGAGTTTA

TTTTTTTGGATCAGGTCAGCCAGAAAAAATATCAGAATTGGAGTTTCATACT GACAAAGTTGACAGTATCCAGTTTTCCAACACTAGTAACAG GTTTG

TGAGTGGTAGTCGTGATGGGACAGCACGAATTTGGCAGTTTAAACGAAGGGAATGGAAAAGCATTTTGTTAGATATGGCTACTCGTCCAGCAGG CCAAA

ATCTTCAAGGCATAGAAGACAAAATCACAAAAATGAAAGTAACTATGGTAGCTTGGGATCGACATGACAACACAGTTATAACTGCAGTTAATAACATGAC

TCTGAAAGTTTGGAATTCTTATACTGGTCAACTGATACATGTTCTAATG GGTCATGAAGATGAGGTGTTTGTTCTTGAGCCACACCCATTTGATCCTAG

AGTTCTCTTCTCTGCTGGTCATGATGGAAATGTGATAGTGTGGGATCTAGCAAGAGGAGTCAAAGTTCGATCTTATTTCAATATG - UNI1408 - AT

TGAAGGACAAGGACATGGTGCAGTGTTTGACTGCAAATGCTCCCCTGATGGTCAGCACTTTGCATGTACAGACTCTCATGGACATCTTTTAATTTTTGGT

TTTGGGTCCAGTAGCAAGTATGACAAG ATAGCAGATCAGATGTTTTTTCACAGTGATTATCGGCCTCTTATCCGTGATGCGAACAATTTTGTATTAGAT

GAGCAGACGCAGCAGGCACCTCACCTCATGCCTCCCCCTTTTCTGGTTGATGTTGATGGAAATCCTCATCCATCAAGGTACCAGCGATTGGTTCCTGGTC

GGGAGAACTGCAGGGAGGAGCAGCTCATTCCTCAGATGGGAGTAACTTCTTCAG GATTGAACCAAGTTTTGAGCCAGCAAGCAAACCAGGATATTAGTC

CTTTAGACAGCATGATTCAAAGACTGCAGCAGGAGCAGGACCTGAGGCGTTCGGGTGAAGCAGGTGTTAGTAATGCCAGCCGTGTGAACAGAG GCTCAG

TAAGTTCTACCTCCGAAGTTCATTCACCACCAAATATAGGATTAAGGCGCAGTGGCCAAATCGAAGGTGTACGGCAGATGCACAGCAATGCTCCGAGAAG

TGAAATAGCCACAGAGCGAGATCTTGTTGCTTGGAGTCGGAGGGTAGTAGTGCCTGAGCTCTCGGCTGGTGTGGCTAG TAGACAAGAAGAATGGAGAAC

TGCAAAGGGAGAAGAGGAAATAAAGAGTTATAGATCAGAAGAGAAAAGGAAACACTTAACTGTTGCAAAAGAGAATAAAATACTTACTGTCTCAAAG AA

TCATGCTCATGAGCATTTCCTGGATCTTGGGGATTCTAAAAAGCAGCAAGCGAATCAGCACAATTACCGTACAAGATCTGCACTGGAAGAAACACCCAGG

CCCTTAGAGGAGCTAGAAAACGGAACTAGTTCTTCAGAT GAAGGTGAAGTACTTGCTGTCAGTGGTGGGACTTCTGAGGAAGAGGAGCGAGCATGGCAC

AGTGATGGCAGCTCCAG TGACTACTCCAGTGATTATTCTGATTGGACAGCAGATGCTGGAATTAACTTGCAGCCACCAAAGAAAGTTCCTAAGCATAAA

ACCAAGAAACCAGAAAGTAGTTCAGATGAAGAAGAAGAATCTGAAAACCAGAAGCAAAAACATATTAAAAAGGAAAGAAAAAAAGCAAATGAAGAAAAAG

ATGGACCAACATCACCAAAGAAAAAAAAGCCCAAAGAAAGAAAACAAAAG AGATTGGCTGTAGGAGAACTAACTGAGAATGGCCTAACGTTAGAAGAGT

GGTTGCCTTCAGCTTGGATTACAGACACACTTCCCAGGAGATGTCCATTTGTGCCACAGATGGGTGATGAG - UNI7196 - GTTTATTATTTTCGAC

AAGGGCATGAAGCATATGTTGAAATGGCCCGGAAAAATAAAATTTATAGTATCAATCCTAAAAAGCAGCCATGGCATAAGATGGAACTAAGG GAACAAG

AACTAATGAAAATTGTTGGTATAAAGTATGAAGTGGGGTTGCCTACCCTTTGCTGCCTTAAACTTGCTTTTCTAGATCCTGATACTGGCAAACTGACCGG

TGGATCATTTACCATGAA ATACCATGATATGCCTGACGTCATAGATTTTCTAGTCTTGAGACAACAATTTGATGATGCAAAGTATAGACGATGGAATAT

AG - UNI11835 - GTGACCGCTTCAGATCTGTCATAGATGATGCCTGGTGGTTTGGAACAATTGAAAGTCAAGAGCCTCTTCAACCTGAGTACCCTG

ATAGTTTGTTTCAGTGTTATAATGTATG TTGGGACAATGGAGATACAGAAAAGATGAGTCCTTGGGATATGGAATTAATACCTAATAATG - UNI836

6 - CTGTCTTTCCAGAAGAACTGGGTACCAGTGTTCCTTTAACTGATGTTGAATGTAGGTCGCTAATTTATAAACCTCTTGATGGAGAATGGGGAGCCA

ATCCCAGGGATGAAGAATGTGAAAGAATTGTTGGAGGAATAAATCAGCTGATGACACTAG ATATTGCGTCTGCATTTGTTGCCCCTGTGGACCTTCAAG

CTTATCCCATGTATTGCACTGTGGTGGCCTATCCAACGGATCTAAGTACAATTAAACAAAGACTGGAGAACAGGTTTTACAG GCGCTTTTCATCACTAA

TGTGGGAAGTTCGATATATAGAACATAATACACGAACATTCAATGAGCCAGGAAGCCCAATTGTGAAATCTGCTAAATTTGTGACTGATCTTCTCCTGCA

TTTTATAAA GGATCAGACTTGTTATAACATAATTCCACTTTACAACTCAATGAAGAAGAAAGTTTTGTCTGACTCTGAG GAAGAAGAGAAAGATGCTG

ATGTTCCAGGGACTTCTACCAGAAAGCGCAAG GATCATCAACCTAGAAGAAGGTTACGCAACAGAGCTCAGTCTTACGATATTCAGGCATGGAAGAAAC

AATGTCAAGAATTACTGAATCTCATATTTCAATGTGAAGACTCAGAACCTTTTCGACAGCCAGTGGATCTTCTTGAATATCCA GACTACAGAGACATCA

TTGACACTCCAATGGACTTTGCCACTGTTAGAGAGACTTTAGAGGCTGGGAATTATGAGTCACCCATGGAGTTATGTAAAGATGTCAGGCTCATTTTCAG

TAATTCTAAAGCATACACACCAAGCAAGAGATCAAGG ATTTACAGCATGAGTTTACGCCTGTCTGCTTTCTTTGAAGAACATATTAGTTCAGTTTTGTC

AGATTATAAATCTGCTCTTCGTTTTCATAAAAGAAACACCATAAGCAAGAAGAGGAAGAAGCGAAACAGGAGCAGTTCCCTGTCCAGCAGTGCTGCCTCA

AG CCCTGAAAGGAAAAAAAGGATCTTAAAACCCCAGCTAAAGTCAGAAGTATCTACCTCTCCATTCTCCATACCTACAAGATCAGTACTACCAAGACAT

AATGCTGCGCAAATGAATGGTAAACCAGAATCCAGTTCTGTGGTTCGAACTAGGAGCAACCGTGTAGCTGTAGATCCAGTTGTCACCGAGCAGCCCTCTA

CATCATCAGCCACAAAAGCTTTTGTTTCAAAAACTAATACATCTGCCATGCCAGGAAAAGCAA TGCTAGAGAATTCTGTGAGACATTCCAAAGCCTTGA

GCACACTTTCCAGCCCTGATCCGCTCACATTCAGCCATGCTACAAAGAATAATTCTGCAAAAGAAAACATGGAAAAGGAAAAGCCTGTCAAACGTAAAAT

GAAGTCTTCTGTGTTTTCAAAAGCATCTCCACTTCCAAAGTCAGCCGCAGTCATAGAGCAAG - UNI12250 - GAGAGTGTAAGAACAATGTTCTTA

TACCAGGAACCATTCAAGTAAATGGCCATGGAGGACAACCATCAAAACTCGTGAAGAGAGGACCTGGGAGGAAGCCCAAGGTAGAAGTTAACACCAGCAG

TGGTGAAGTGACACACAAGAAAAGAGGTAGAAAGCCCAAGAATCTGCAGTGTGCAAAGCAGGAAAACTCTGAGCAAAATAACATGCATCCCATCAGGGCT

GACGTGCTTCCTTCTTCAACATGCAACTTCCTTTCTGAAACTAATGCTGTCAAGGAGGATTTGTTACAGAAAAAGAGTCGTGGAGGCAGAAAACCCAAAA

GGAAGATGAAAACTCACAACCTAGATTCAGAACTCATAGTTCCTACAAATGTTAAAGTGTTAAGGAGAAGTAACCGGAAAAAAACAGATGATCCTATAGA

TGAGGAAGAGGAGTTTGAAGAACTCAAAGGCTCTGAGCCTCACATGAGAACTAGAAATCAGGGTCGAAGGACAGCTTTCTATAATGAGGATGACTCGGAG

GAAGAACAGAGACAGCTGTTGTTCGAGGACACCTCCTTGACATTTGGAACTTCTAGTAGAGGACGAGTCCGAAAGTTGACTGAAAAAGCAAAGGCTAATT

TAATTGGTTGGTAACTTGAAGCAAAATATTGCATTTTAAAAAATCTGTAACGCAGGTACAGTTAAGGAGTAAGTAGAACTAAGGTCTCTGCTTCCTTGCT

GCTATGACGGATTAGGGAATGTTACAATTTGACTTGGGAAAATGGACAAAAACACATTTAGAAGATAATTTACATCTTTGAATGAAAAAAATCTATATAC

ATATATATTTCAAATGTTTGCTATTTATTGCCCTTAGGTAGGTTATTCGGTTCCACATTCATTTCATTTGCTGTTTGAAATTGAGGACCTGTTATAAATT

CTGGTTTATTTATGGAAGAGACAGCTCTGCTACACTATTAAGAAACATAGTATTCCTAGAGATAAAGTATGTTTCCTCTTAAATTGAGTTATTTTTGACC

AAGTGAGGTACATTTTTACTGATAGCAGAAGGCATGCCCTAGGAAGAGAGATGTTACAAAGAGTAGCAGTACATTAAGAATGGCTTCCTCTAAAGATAAC

TTTCCAGTTCCCACCATTTGTTATCCTGAAAAGTGTTGTGAACTGTAGGTGTTCAATTACAGAATATCTAGAGGAAGCTTTTGTTTTACTCCATTTCTGC

CAAACTTAGGAGAAAAATGTATTGATGCAAAGGAAACATATCCACATTGGAAAACATTTGACTGTCTAATTTTTCAGACCTTGATTCTTATATCAGTCAC

TCTATCTCTGTTTATTGTGCCAAAGACTGAGAATCAGTGCAGTGGAAAGCCTGTTTTTGACTGTCAGGACAGCATACACTTTTCAGTACTGGAAAAGCTA

TATATTCTAAAGAGCAAGTTATTACAAAATTATGCTGAGTTATATCTTTTTTTTGGTACTAAATGTAGGAAAATAATGCACTGGTGGGTCCTTTGACAGA

GATATCTTAGAGAAAATGTTTAAGTGGTTAAAGGATTCAAGGACAATACAGGAAACATGTATGGAATTTGATGTTTACTTGATCTGGATTAATGTCATTT

TTAAACTTCAGACATATCCAGTAGGCTAAAATGACTTAAAAAGAACCATGTCTGTGTGTGTGTGTATATTGATAAATGGGTGTGATTGAATATATATATA

CAAACGCATTCTTAAGTACTATTACCCAGGTATAAATTCTTTTTTCAGGATTTTTTAGATAGTAGTAGAATAAAAATAATTTTAAAATGTCATACTTTAT

AGTTTAATTTTAAGGAAAAGATTGGTTATTTTCAATTATTAAAAGTTAAAAATAGGCCAAATCACTTTTTATGCAATCATGTTTTATACAGTGGTCTCAT

TGCACATTGTGTTTTTTCTGCACTTTTTACGGTATCCTTATCAAGCTGGTATCTCAATATACACTCTAAAGAGAATCTCTCATTTAATGATTGTGCCTTG

TATTCTATTATTTTTTGCATCATTAGTAAAATTAAGTTGTCTATTGTAAATGATAACTATATGACTTAGGGGAATGTATTTCTATATGTACTGCTGTGGG

AAAAGGAAAGCAGTTATTTATTTGTTTATGGTACATTAGTTATTTTATATCTTGAAAACCAACATAAATGCCATTTCTATTGTTTAAAATTACTTTTTTT

TTTTTGGTAAGTTTTAAGAATGTAGTATTTTCTGAGAACTGATATGGTACAAAGATGTAACCAAATCTTTCAGATACTACATTTTTAAAAAGGAAGGATG

GGGAAAATATATATCAGCATGACCCTGATGTAGAGAATAAAGTCTTTAATTGAACCTTGGCAAAATATGTAATTAGATTATAATTGTTTCCTTGTTTCCA

ATACGGATAAATGTTAACTGTCAGTCTTGAAGAAGAATGAAAAGTAATGCATTTGGGCTTTTTAGATCATTTATAATGAAATTTGTACAGAAACCCTCCA

GTGAAACTAAGTGAACCATTTTCCAGACCTTGACTGGATTGCTGTGATTTTACAGTTAAAAAATAATTTCAAAATTTTTAGGTTTTTTGTACATTTATTT

TTTTCTAACAAATATATTGAACTATATAATTAAAATTAAGTAGTTACTCTTCATAATGCAGAAACGGATGATGTTATAGAAAAATGAGTCGATTTCACCA

TTACTGAAAATGATAGTGTGTACATTGGAAATTTAAGTCATTAAAGTAATTAGTTACTTTTGAAGGGAATCTATTTGAGAAATGTAATTTCCTGATGTTA

TCTGCATTGTAGTAGAAAATTAGACTAAAATCCATTTTTATAAATAAATGTAGTTATAAGGTGTGTTCAATATAAGGAAGTGCGCACAGTCTTAGTGTGG

AGGACCTCTAGAATGGGGCACAGAGAGTTCCAACCTCTGAGCAGTGATCTCCATCTCTCTTATAACAAGGAAATAGAACATTTCTGTGTTAAAGACACTG

TGTATTCATGACCGTATTTGGACATTTTTAGACAATGGTTTCTTAGTAAAGTAAAATGACTTGGATTGCATTATTTGTAACTGAAAACTTAAGATATATT

AATACCAGTTACAGATGTTATATTTTTATAATTTAGCTTCTGTACATTGCAGAAGATAAATTATGAACTTTAAATCATCATGTTTTGGTTTGTTTTACTG

CTTGGAAAAGTCTCCTCTTTGCAACAGTAACATCCTGTATGTACTGTTTGTACGTCAGAAGGAGTTGTTAGCGCTCACTTAGGTATGCAGTAAGAAACAT

CTCGTTTATCAGAAAGGAAATTTATTATGTACATGGAACATAGATACCAGTTTTCAGGCTGAGTTGAGTGGTCCATGCCTATAATCCCAGCATTTGGGAC

ATGGAGACAGGAACATCCAAGAGTTCAAAGTTAACCTTTAATGGCAAACCAAGTTCAAGACTAGGGCTATAAAAGCAGCAATACCAAAAAGCCTCAGTTT

ATATTTCTAATATTCAACCATATTGTTATACTATCCTGACTTCACGAAGCCCAAGTTTAGTAGAAGTTTCAGTGTTGTCACAGGAGTAGTTTAAAGACTC

AGTCTAATTGCAGTCTCCCAGCCTTTGGAAGTAGAGATGTAGCATCCAAAGGTCTCACCCCTCACAGTCTCTCTAGAGAGGTCTTTGTCTTCTGCATAAA

CAGATAATTAAGGGCCTTATTTCCATTGTTGTTTTGCAGTGTTTCACTACAACTAAAGGTTGGTGGGTTACTAAAGAATTGTCATACTCTAATTAGATAG

CTATGGAACATTTGTCAGATAGTTAGGCCACATCGGAGATACATGATTGATTGACTGGAAGCAGTTTCACTTGAAAATGACTTACGTAGGACAGTGAACA

GCAAACATTCTCATACATAATCATTAACAGAACTGCCTCTTGGCTGTAGTGTAGTAGACTAACTGGAACCTTCAAGGGTTATTGAGATAAAGTTCAGCCC

TGCATGATGTTAGCAGCGTTCACACAGTTAGTTTCAGTTGACAGTGTTTTATTTTGACATTCCATTTTGTATCATCATAGCTATCTATAAGCTTCTCTCC

AATGTAAGTTAAAAGTATGTGGTTTCAAGCTTTCTATCTAAGAAAACAAACTGATTTTAATATTTTGTTTGCGTGAAGTTTATTTTTGAGTAGGTTGAAA

GGACCAAGATACTTGAGTTACTAAAGGGCTATTACCAATGTTCATCCTATATGCAGGAGGTGTACAGTATTTTAAAAGTGAATAGGGTGGAGATTGCTTT

TATTTAGAATGCATTAGCCCCATATTATCCAGAAGATACTGCTAACAGTAGTAGCTTAATTAGGCAGTAAGTTGTCTTAGGTTAAAAATTGGGAAAAGTA

CACCTTTTGTTTCCATCCAAAAAAATGATTTTTAGATGACTTCAACTAAAATTAATGCATCTACTAAGAAACTATTTTGTTTTTAATTATAATTATCAAA

ATGATCCAAATGAAAAGACATTCTCAACTATGTACAGTACTCCAGGAGGAGGTCTAATTGAGTCAGAAGACTGTAAGTACCACTTTGAGCGCTCTGGAGA

TCAACCCACACAAGTACAGTGAGTAGATTATCTGAGCTATAAATATATTTTTTAGTTTCAATAGCTCTGTTTTGAAATACTTTTTTAATGCAGATAAAAA

AAATCAGGAAATTAACCTTATATGGCACAAACCAAATACATAGTAGTATATGGATGAGTTTCTACATTTAAAGAACTAAGAAGATAGGTTCAGGATTGTA

TTATAGTACATGCACTTACATGCAGATACACATGCTGATTACTTTCAAGGATGTGTGTGTTGGTTTATCACAACAATAAATTTAAAAGTAAGATACAATG

TTACATTTTTAGACCATATTGAAACAGCAAGAAGAGACAGGTCTTAAAAAGTTATTAAGAAAACTACTTAATCCCACCATGGGATATTTAGAGGTCTAAA

TATAGCTCAATTTTAAAAAGCAACTGACCTAAAGGGTTAATGTTGTAACTGACACATTTCAAATTAAAATTATGTTTATTTTGTACAGAAAGCAATGTTA

AACACAAGCAGATCTGTTGTATGTAATAAGTGACAGAGTTTTTAAAATTATTTAGCTTTACGGATGTTGTTTTATTTCTTCTAGACCTGGAGCACCGTGT

CATAAGTGGCAGCCTTGCTCCACGGTAGCAGGCTCTTTCTTTTGTACATACTGATCGGACCTTCTTTACTGTTCCGTGGACACTTTCTATGTTAGTTTTG

ATGCATAATTCTTGGAATCCTTTTATACAAACTAGAATGTATGTGTAAGAATTCCTGTCCCTGCAATGTAGTAACTATAAACTTATTTTTAAATAAATAG

AAAACTTGTTTTTCTAAGCCATTTTGTAGAGCCTCATGATTTCTTTGCTTTTCTGTTTATTTTGATTAGTTTTGGACAGCATAAAGCACTTGGTACGTAC

TCAGTAGGCAGCTTACCAAAGCAATTGTGAAATAGAAGCCATTATGTAAATTCTGGTTTGTTAGAGGTTCCACTTTTCTGTCTATTTGTGAAATGTTAAA

ATCATTATCAAAGATTTCAATCACCTAATGTAATTCCAGAGTGACTGAAGGTTAAAAAATAAAGATGCCTTTGCCTTTC
Translation
MSRERKGLSELRSE ELYFLIARFLEDGPCQQAAQ VLIREVAEKE - UNI25460 - LLPRRTDWTGKEHPRTYQNL - UNI7138 - VKYYRHL

APDHLLQICHRLGPLLEQEIPQSVPGVQTLLGAGRQSLLRTNKS SCKHVVWKGSALAALHCGRPPESPVNYGSPPSIA - UNI9368 - ADTLFSRK

LNGKYRLERLVPTAVYQHMKMHKRILGHLSSVYCVTFDRTGRRIFT - UNI2795 - GSDDCLVKIWATDDGRLLATLRGHAAEISDMAVNYENTMIA

AGSCDKMIRVWCLRTCAPLAVLQGHSASITSLQ FSPLCSGSKRYLSSTGADGTICFWLWDAGTLKIN NPRPTKFTERPRPGVQMICSSFSAG GGMFL

ATGSTDHIIRVYFFGSGQPEKISELEFHT DKVDSIQFSNTSNR RFVSGSRDGTARIWQFKRREWKSILLDMATRPAG GQNLQGIEDKITKMKVTMVA

WDRHDNTVITAVNNMTLKVWNSYTGQLIHVLM GHEDEVFVLEPHPFDPRVLFSAGHDGNVIVWDLARGVKVRSYFNM - UNI1408 - IEGQGHGAV

FDCKCSPDGQHFACTDSHGHLLIFGFGSSSKYDK IADQMFFHSDYRPLIRDANNFVLDEQTQQAPHLMPPPFLVDVDGNPHPSRYQRLVPGRENCREEQ

LIPQMGVTSSG GLNQVLSQQANQDISPLDSMIQRLQQEQDLRRSGEAGVSNASRVNRG GSVSSTSEVHSPPNIGLRRSGQIEGVRQMHSNAPRSEIAT

ERDLVAWSRRVVVPELSAGVAS SRQEEWRTAKGEEEIKSYRSEEKRKHLTVAKENKILTVSK NHAHEHFLDLGDSKKQQANQHNYRTRSALEETPRPL

EELENGTSSSD EGEVLAVSGGTSEEEERAWHSDGSSS SDYSSDYSDWTADAGINLQPPKKVPKHKTKKPESSSDEEEESENQKQKHIKKERKKANEEK

DGPTSPKKKKPKERKQK RLAVGELTENGLTLEEWLPSAWITDTLPRRCPFVPQMGDE - UNI7196 - VYYFRQGHEAYVEMARKNKIYSINPKKQP

WHKMELR EQELMKIVGIKYEVGLPTLCCLKLAFLDPDTGKLTGGSFTMK KYHDMPDVIDFLVLRQQFDDAKYRRWNIG - UNI11835 - GDRFRS

VIDDAWWFGTIESQEPLQPEYPDSLFQCYNVC CWDNGDTEKMSPWDMELIPNNA - UNI8366 - AVFPEELGTSVPLTDVECRSLIYKPLDGEWGA

NPRDEECERIVGGINQLMTLD DIASAFVAPVDLQAYPMYCTVVAYPTDLSTIKQRLENRFYR RRFSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTD

LLLHFIK KDQTCYNIIPLYNSMKKKVLSDSE EEEKDADVPGTSTRKRK DHQPRRRLRNRAQSYDIQAWKKQCQELLNLIFQCEDSEPFRQPVDLLEY

P DYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSR IYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTISKKRKKRNRSS

SLSSSAASS SPERKKRILKPQLKSEVSTSPFSIPTRSVLPRHNAAQMNGKPESSSVVRTRSNRVAVDPVVTEQPSTSSATKAFVSKTNTSAMPGKAM M

LENSVRHSKALSTLSSPDPLTFSHATKNNSAKENMEKEKPVKRKMKSSVFSKASPLPKSAAVIEQG - UNI12250 - GECKNNVLIPGTIQVNGHGG

QPSKLVKRGPGRKPKVEVNTSSGEVTHKKRGRKPKNLQCAKQENSEQNNMHPIRADVLPSSTCNFLSETNAVKEDLLQKKSRGGRKPKRKMKTHNLDSEL

IVPTNVKVLRRSNRKKTDDPIDEEEEFEELKGSEPHMRTRNQGRRTAFYNEDDSEEEQRQLLFEDTSLTFGTSSRGRVRKLTEKAKANLIGW

For any suggestions or comments, please send an email to unitrap@crg.es