Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032267 (Usp28)
Chromosomal location
Chr 9: 48793490 - 48850622 (+)
Description
ubiquitin specific peptidase 28 Gene [Source:MGI Symbol;Acc:MGI:2442293]
RefSeq_dna
NM_175482 
RefSeq_peptide
NP_780691.2 
UniGene
Mm.21630 
MGI
MGI:2442293 
Uniprot/SWISSPROT
Q5I043 
Uniprot/SPTREMBL
Q8BZ53 Q3TLH2 Q8BMT7 
Human Ortholog
ENSG00000048028 (USP28)
Omim not available
UniTrap UNI2326
Vector Insertion
Chr 9: 48793643 - 48808455
Public Clones AE0197 (sanger) AG0122 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16290
Vector Insertion
Chr 9: 48793643 - 48808454
Public Clones (sanger) D107B03 (ggtc) E061C01 (ggtc) E027D10 (ggtc) IST14325A4 (tigm)
IST14898E12 (tigm) IST12262F4 (tigm)
Private Clones OST463975 (lexicon) OST297183 (lexicon) OST271322 (lexicon) OST66123 (lexicon)
OST53733 (lexicon) OST33244 (lexicon) OST30712 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3886
Vector Insertion
Chr 9: 48823356 - 48824786
Public Clones AW0173 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21437
Vector Insertion
Chr 9: 48826573 - 48832010
Public Clones IST13410B3 (tigm) IST13175A2 (tigm) IST13490B10 (tigm) IST13085B6 (tigm)
IST13361B7 (tigm) IST13316A3 (tigm) IST13168B7 (tigm) IST13084A6 (tigm)
Private Clones OST330055 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21072
Vector Insertion
Chr 9: 48832191 - 48833872
Public Clones (sanger)
Private Clones OST342021 (lexicon) OST294918 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12735
Vector Insertion
Chr 9: 48839027 - 48840318
Public Clones W007C10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37800
Vector Insertion
Chr 9: 48840794 - 48841681
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30201
Vector Insertion
Chr 9: 48843877 - 48843986
Public Clones D080H10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11686
Vector Insertion
Chr 9: 48845997 - 48847086
Public Clones P077H09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034805
Sequence
GAGCTGCCAGATGCTGTTAAATCAGCTGCGAGAAATCACAGGCATCCAGGATCCTTCCTTTCTTCATGAAGCATTAAAG GCCAGTAATGGTGACATCAC

CCAGGCTGTCAGCCTTCTCACAGACCAAAGAGTTAAGGAGCCCAGTCACGACACAACTGCTGCAGAACCATCTGAAGTAGAAGAGAGTGCTACCAGCAAA

GATCTCTTAGCAA AAGTGATAGACCTCACTCACGACAACAAAGATGACCTGCAGGCAGCCATTGCCTTGAGTCTCCTGGAGTCTCCTAACATTCAGGCT

GACAACAGAGATCTTAATAG AGCGCATGAGGCTAACTCTGCAGAAACTAAACGCTCAAAGAGAAAACGCTGTGAAGTTTGGGGAGAAAACCACAATCCC

AATAACTGGAGGAGAGTGGATGGTTGGCCAGTTGGGCTGAAAAATGTTGGCAACACATGTTGGTTCAGTGCTGTTATTCAG TCTCTCTTTCAGTTGCCT

GAATTTCGAAGACTTGTTCTCAGTTATAACCTGCCACAGAACATCCTTGAAAATTGTCGAAGTCACACT GAAAAGAGAAATATCATGTTTATGCAAGAG

CTTCAGTATTTATTTGCTCTGTTGTTGGGATCAAATCGAAAATTTGTAGACCCTTCTGCAGCCCTGGATCTACTGAAGGGAGCCTTCCGATCATCCGAGG

AGCAGCAG CAAGATGTGAGTGAATTCACACACAAGCTCCTGGATTGGCTGGAGGATGCGTTCCAGCTAGCTGTTAATGTTAA CAGCCATCTCAGGAAT

AAATCTGAAAATCCCATGGTGCAGCTATTCTACGGTACTTTTCTGACAGAAGGGGTCCGAGAAG GAAAGCCCTTTTGTAACAATGAGACCTTCGGCCAG

TATCCTCTTCAGGTAAACGGTTACCACAACTTAGACGAATGTTTGGAAGGGGCCATGGTGGAAGGTGACATCGCGCTGCTTCCTTCGGATCGTTCCGTGA

AGTATGGGCAGGAG - UNI3886 - CGTTGGTTTACAAAGCTGCCTCCAGTGTTGACCTTTGAACTCTCCAGATTTGAGTTTAATCAGTCTCTTGGGC

AGCCTGAAAAAATTCATAATAAGCTGGAATTTCCTCAGATTATCTATATGGATAG GTACATGTATAAGAGCAAAGAGCTTATCCGAAGTAAGAGAGAGA

GCGTTCGGAAGTTGAAGGAGGAAATACAAGTTCTGCAGCAGAAGTTAGAAAG - UNI21437 - GTATGTGAAGTACGGCTCGGGCCCATCTCGGTTC

CCACTTCCCGACATGTTGAAATACGTTATTGAATTTGCCAGTACAAAACCTGCCTCTGAAAGCTGTCTGTCTGGAAGTGCTGAGCATGTGACATTACCAC

TTCCCTCGGTGCACTGCCCGATTTCTGACCTCACACCCAAGGAAAG - UNI21072 - TTCAAGTCCAGAAAGCTGCTCTCAGAATGCTGGAAGTACC

TTTTCCTCTCCAGAAGATGCTCTTCCCAGCTCTGAGGGGATGAATGGGCCATTTACCTCTCCTCACTCGTCTCTGGAAACGCCTGCACCCCCAGCTCCTC

GGACAGTCACAGATGAAGAAATGAACTTCGTTAAGACCTGTCTTCAGAGGTGGCGGAGTGAAATTGAACAGGATATACAAG ACCTAAAGAACTGTATCT

CGAGCAGCACGAAGGCGATTGAGCAGATGTACTGTGACCCTCTTCTTCGTCAG GTGCCTTATCGCTTACATGCAGTTCTTGTTCACGAAGGACAAGCCA

GTGCAGGACACTACTGGGCATACATCTACAACCAGCCCCGGCAGACCTGGCTCAAATACAACGACATCTCTGTTACTGAGTCTTCCTGGGAGGAACTTGA

AAGAGATTCTTACGGGGGCCTGAGAAATGTCAGCGCCTACTGCTTGATGTATATCAATGACAACTTGCCCCACTTCAGTGCAG AGGCATCTTCTAATGA

ATCTGATGAGACTGCAGGAGAAGTGGAAGCCCTGTCTGTGGAACTCAGGCAGTACATTCAGGAAGATAACTGGAGGTTTCAGCAAGAGGTGGAGGAATGG

GAGGAAGAACAGTCCTGTAAGATCCCACAGATGGAGTCCTCCCCGAACTCTTCCTCACAGGATTTCTCCACATCACAAG - UNI12735 - AGTCTCC

AGCAGTGTCCTCTCATGAGGTCCGATGCTTGTCTTCTGAGCATGCTGTGATTGCAAAAGAACAGACTGCCCAGGCAATTGCCAACACAGCTCATGCCTAC

GAGAAGAGTGGTGTAGAAGCAGCCTTGAGTGAG CATAATGAAGCTGAGCCCAAGAAGCCCCAGGAAACAAACCTTGCAGAGCAGTTAGAGCAGGCGGCC

GAGGCCAGGGACACGGAGGCTGCTGCCGCACCTAACTCTGAGGTCTCTGAAGTGGAGATTCCCAGTGTGGGAAGGATTCTTGTTAGGTCTGATGCAGATG

GCTATGATGAGGAG GTGATGCTGAGCCCTGCCATGCAAGGGGTCATCCTGGCCATAGCTAAAGCACGCCAGACCTTTGACCGAGATGGGTCTGAAGCAG

GGCTTATTAAG GCATTTCATGAGGAGTACTCCAGGCTCTATCAGCTTGCCAAAGAGACACCCACCTCTCACAGTGACCCTCGCCTTCAGCATGTTCTTG

TCTACTTTTTCCAAAATGAAGCACCCAAGAGGGTAGTAGAACGGACCCTTCTGGAACAGTTTGCGGATAGAAACCTTAGCTATGATGAGAG - UNI302

01 - ATCTATCAGTATCATGAAGGTGGCTCAGGCCAAATTGATGGAAATTGGTCCAGATGACATGAACATGGAAGAGTATAAG - UNI11686 - GA

GCTGAATGCCAAGGCTGCTTCTCTTTTTGAAACAAATGACGACCATTCTGTAACAGAGGGCATTAATGTAATGAATGAGTTGATCATTCCCTGCATCCAC

CTGATCATTAATAACGACATCTCCAAGGACGACCTCGATGCCATCGAGGTCATGAGGAACCACTGGTGCTCTTACCTGGGGAAGGATATTGCAG AGAAT

CTGCAGCTGTGCTTAGGAGAGTTCCTACCCAGGCTTCTAGATCCTTCTGCAGAAATCATCGTCCTAAAGGAGCCTCCAACTATTCGACCGAATTCTCCCT

ATGATCTTTGCAACCGGTTTGCAGCTGTCATGGAGTCCATTCAAGGAGTTTCAACAGTAACCGTGAAATAAGCCGCTCATGGACAGTCAAGACTCAGTCT

GGTCTCCGGTCCCCTGCCTGTTATGTGGCAGTCTGTTGTGACAGATTTCCCTGGACAGAGGGATTGGGTGTCTGAGCGAGATTCAGACCCTCCCCCCTCT

CGTGATGTGTGTTTAAGGGATTAAGGATAAAGTTGCACATTTTAGGTACAGAACCACAAGAGCTATTTCACTGAAGAAGGCAGGAGCCAGTGCATTAAGG

TTTTGAATTATCCTAGAAGACCTGAACTGCCTTTGTAAATCTCCCATAACACTTGGGTTTGTCTAAACCTCGTGCCACTTTTAAATTACCCTTCAGGCAC

CAGTCTTTGACAGCAAAAGGGTGACTCATCAGAACTGAGCCAGGGGAGCAGTTTCTAGTTATTTTGTCAAGTTCAGGTGACATTTAAAAGTCCTCAGCTA

CCAGAGATTGGTAGTAGGGGTCTTGCCTGGCTCTTGCCAGTGATGAAAAGAGGTGCTGGTGAGCCCTTCCTTCCACATAAGGCTGCGCCATGAAGCCGCC

AAGGGAAAGCTGCATCCCCCTTTGGTCTGTTTATACTTTAGATAAACCAGAAAACCTCACATTCAGTCTTGAGTGAAAGAAAAGAAAGCATCCTGGGCTT

CCAGCCCTGTGCTGGTGTGACAGATGCCACACAAGGAACACTTAATAGTTAATAATCATCAGAAGCAGGTGTCTAAGGCTACCCGGCCTAAGAGAATTTT

GATCCTTTCTCTCCCTTTTTTTTTTTTAAAGAAAATAAGGGATGTGAATTTGTATAAAAAATAACATCTATCTGTGTATATGTAGAAAGAAGCTGCTTTT

TAAAGAACTTCTAATTGGAAACTCATGTTTTAACCAAATTTTAAGGATTAATGGAGCAATCATGGGAGGGAAGAACACAATACAACTATGCAGGTTTTAT

AAATGTGCAATAAAAGTATTTGTTTTACCTTT
Translation
        MVEGDIALLPSDRSVKYGQE - UNI3886 - RWFTKLPPVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDR RYMYKSKELIRSKRE

SVRKLKEEIQVLQQKLER - UNI21437 - RYVKYGSGPSRFPLPDMLKYVIEFASTKPASESCLSGSAEHVTLPLPSVHCPISDLTPKES - UNI2

1072 - SSSPESCSQNAGSTFSSPEDALPSSEGMNGPFTSPHSSLETPAPPAPRTVTDEEMNFVKTCLQRWRSEIEQDIQD DLKNCISSSTKAIEQMY

CDPLLRQ VPYRLHAVLVHEGQASAGHYWAYIYNQPRQTWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMYINDNLPHFSAE EASSNESDETAGEV

EALSVELRQYIQEDNWRFQQEVEEWEEEQSCKIPQMESSPNSSSQDFSTSQE - UNI12735 - ESPAVSSHEVRCLSSEHAVIAKEQTAQAIANTAH

AYEKSGVEAALSE HNEAEPKKPQETNLAEQLEQAAEARDTEAAAAPNSEVSEVEIPSVGRILVRSDADGYDEE VMLSPAMQGVILAIAKARQTFDRDG

SEAGLIK AFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAPKRVVERTLLEQFADRNLSYDER - UNI30201 - RSISIMKVAQAKLMEIGP

DDMNMEEYK - UNI11686 - ELNAKAASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGKDIAE ENLQLCLGEF

LPRLLDPSAEIIVLKEPPTIRPNSPYDLCNRFAAVMESIQGVSTVTVK
Transcript ENSMUST00000047349
Sequence
GGTGCTCCCGGGCTTCGGGGGCGGTGGTGGTGGCGGTGGCGACCGCGGCGAAGACGACAACGAGAGTGGGGCTACACGCGGAGGGACACCACGGCCATGA

CTGCGGAGCTGCAGCAGGACGACTCGGCGGGGGCGGCGGACGGCCATGGCTCG - UNI2326 - - UNI16290 - AGCTGCCAGATGCTGTTAAAT

CAGCTGCGAGAAATCACAGGCATCCAGGATCCTTCCTTTCTTCATGAAGCATTAAAG GCCAGTAATGGTGACATCACCCAGGCTGTCAGCCTTCTCACA

GACCAAAGAGTTAAGGAGCCCAGTCACGACACAACTGCTGCAGAACCATCTGAAGTAGAAGAGAGTGCTACCAGCAAAGATCTCTTAGCAA AAGTGATA

GACCTCACTCACGACAACAAAGATGACCTGCAGGCAGCCATTGCCTTGAGTCTCCTGGAGTCTCCTAACATTCAGGCTGACAACAGAGATCTTAATAG A

GCGCATGAGGCTAACTCTGCAGAAACTAAACGCTCAAAGAGAAAACGCTGTGAAGTTTGGGGAGAAAACCACAATCCCAATAACTGGAGGAGAGTGGATG

GTTGGCCAGTTGGGCTGAAAAATGTTGGCAACACATGTTGGTTCAGTGCTGTTATTCAG TCTCTCTTTCAGTTGCCTGAATTTCGAAGACTTGTTCTCA

GTTATAACCTGCCACAGAACATCCTTGAAAATTGTCGAAGTCACACT GAAAAGAGAAATATCATGTTTATGCAAGAGCTTCAGTATTTATTTGCTCTGT

TGTTGGGATCAAATCGAAAATTTGTAGACCCTTCTGCAGCCCTGGATCTACTGAAGGGAGCCTTCCGATCATCCGAGGAGCAGCAG CAAGATGTGAGTG

AATTCACACACAAGCTCCTGGATTGGCTGGAGGATGCGTTCCAGCTAGCTGTTAATGTTAA CAGCCATCTCAGGAATAAATCTGAAAATCCCATGGTGC

AGCTATTCTACGGTACTTTTCTGACAGAAGGGGTCCGAGAAG GAAAGCCCTTTTGTAACAATGAGACCTTCGGCCAGTATCCTCTTCAGGTAAACGGTT

ACCACAACTTAGACGAATGTTTGGAAGGGGCCATGGTGGAAGGTGACATCGCGCTGCTTCCTTCGGATCGTTCCGTGAAGTATGGGCAGGAG - UNI38

86 - CGTTGGTTTACAAAGCTGCCTCCAGTGTTGACCTTTGAACTCTCCAGATTTGAGTTTAATCAGTCTCTTGGGCAGCCTGAAAAAATTCATAATAA

GCTGGAATTTCCTCAGATTATCTATATGGATAG GTACATGTATAAGAGCAAAGAGCTTATCCGAAGTAAGAGAGAGAGCGTTCGGAAGTTGAAGGAGGA

AATACAAGTTCTGCAGCAGAAGTTAGAAAG - UNI21437 - GTATGTGAAGTACGGCTCGGGCCCATCTCGGTTCCCACTTCCCGACATGTTGAAAT

ACGTTATTGAATTTGCCAGTACAAAACCTGCCTCTGAAAGCTGTCTGTCTGGAAGTGCTGAGCATGTGACATTACCACTTCCCTCGGTGCACTGCCCGAT

TTCTGACCTCACACCCAAGGAAAG - UNI21072 - TTCAAGTCCAGAAAGCTGCTCTCAGAATGCTGGAAGTACCTTTTCCTCTCCAGAAGATGCTC

TTCCCAGCTCTGAGGGGATGAATGGGCCATTTACCTCTCCTCACTCGTCTCTGGAAACGCCTGCACCCCCAGCTCCTCGGACAGTCACAGATGAAGAAAT

GAACTTCGTTAAGACCTGTCTTCAGAGGTGGCGGAGTGAAATTGAACAGGATATACAAG ACCTAAAGAACTGTATCTCGAGCAGCACGAAGGCGATTGA

GCAGATGTACTGTGACCCTCTTCTTCGTCAG GTGCCTTATCGCTTACATGCAGTTCTTGTTCACGAAGGACAAGCCAGTGCAGGACACTACTGGGCATA

CATCTACAACCAGCCCCGGCAGACCTGGCTCAAATACAACGACATCTCTGTTACTGAGTCTTCCTGGGAGGAACTTGAAAGAGATTCTTACGGGGGCCTG

AGAAATGTCAGCGCCTACTGCTTGATGTATATCAATGACAACTTGCCCCACTTCAGTGCAG AGGCATCTTCTAATGAATCTGATGAGACTGCAGGAGAA

GTGGAAGCCCTGTCTGTGGAACTCAGGCAGTACATTCAGGAAGATAACTGGAGGTTTCAGCAAGAGGTGGAGGAATGGGAGGAAGAACAGTCCTGTAAGA

TCCCACAGATGGAGTCCTCCCCGAACTCTTCCTCACAGGATTTCTCCACATCACAAG - UNI12735 - AGTCTCCAGCAGTGTCCTCTCATGAGGTC

CGATGCTTGTCTTCTGAGCATGCTGTGATTGCAAAAGAACAGACTGCCCAGGCAATTGCCAACACAGCTCATGCCTACGAGAAGAGTGGTGTAGAAGCAG

CCTTGAGTGAG GCATTTCATGAGGAGTACTCCAGGCTCTATCAGCTTGCCAAAGAGACACCCACCTCTCACAGTGACCCTCGCCTTCAGCATGTTCTTG

TCTACTTTTTCCAAAATGAAGCACCCAAGAGGGTAGTAGAACGGACCCTTCTGGAACAGTTTGCGGATAGAAACCTTAGCTATGATGAGAG - UNI302

01 - ATCTATCAGTATCATGAAGGTGGCTCAGGCCAAATTGATGGAAATTGGTCCAGATGACATGAACATGGAAGAGTATAAG AGGTGGCATGAAGAT

TATAGTCTGTTCCGAAAGGTGTCTGTGTACCTTCTAACGGGCCTGGAACTCTTCCAAAAAGGAAA GTACCAGGAAGCATTGTCCTACCTGGTGTACGCA

TACCAGAGCAACGCTGGCCTGCTGGTGAAGGGGCCCCGAAGGGGCGTGAAGGAGTCTGTGATTGCCTTATACCGCAGAAAATGCCTTCTG - UNI1168

6 - GAGCTGAATGCCAAGGCTGCTTCTCTTTTTGAAACAAATGACGACCATTCTGTAACAGAGGGCATTAATGTAATGAATGAGTTGATCATTCCCTGC

ATCCACCTGATCATTAATAACGACATCTCCAAGGACGACCTCGATGCCATCGAGGTCATGAGGAACCACTGGTGCTCTTACCTGGGGAAGGATATTGCAG

 AGAATCTGCAGCTGTGCTTAGGAGAGTTCCTACCCAGGCTTCTAGATCCTTCTGCAGAAATCATCGTCCTAAAGGAGCCTCCAACTATTCGACCGAATT

CTCCCTATGATCTTTGCAACCGGTTTGCAGCTGTCATGGAGTCCATTCAAGGAGTTTCAACAGTAACCGTGAAATAAGCCGCTCATGGACAGTCAAGACT

CAGTCTGGTCTCCGGTCCCCTGCCTGTTATGTGGCAGTCTGTTGTGACAGATTTCCCTGGACAGAGGGATTGGGTGTCTGAGCGAGATTCAGACCCTCCC

CCCTCTCGTGATGTGTGTTTAAGGGATTAAGGATAAAGTTGCACATTTTAGGTACAGAACCACAAGAGCTATTTCACTGAAGAAGGCAGGAGCCAGTGCA

TTAAGGTTTTGAATTATCCTAGAAGACCTGAACTGCCTTTGTAAATCTCCCATAACACTTGGGTTTGTCTAAACCTCGTGCCACTTTTAAATTACCCTTC

AGGCACCAGTCTTTGACAGCAAAAGGGTGACTCATCAGAACTGAGCCAGGGGAGCAGTTTCTAGTTATTTTGTCAAGTTCAGGTGACATTTAAAAGTCCT

CAGCTACCAGAGATTGGTAGTAGGGGTCTTGCCTGGCTCTTGCCAGTGATGAAAAGAGGTGCTGGTGAGCCCTTCCTTCCACATAAGGCTGCGCCATGAA

GCCGCCAAGGGAAAGCTGCATCCCCCTTTGGTCTGTTTATACTTTAGATAAACCAGAAAACCTCACATTCAGTCTTGAGTGAAAGAAAAGAAAGCATCCT

GGGCTTCCAGCCCTGTGCTGGTGTGACAGATGCCACACAAGGAACACTTAATAGTTAATAATCATCAGAAGCAGGTGTCTAAGGCTACCCGGCCTAAGAG

AATTTTGATCCTTTCTCTCCCTTTTTTTTTTTTAAAGAAAATAAGGGATGTGAATTTGTATAAAAAATAACATCTATCTGTGTATATGTAGAAAGAAGCT

GCTTTTTAAAGAACTTCTAATTGGAAACTCATGTTTTAACCAAATTTTAAGGATTAATGGAGCAATCATGGGAGGGAAGAACACAATACAACTATGCAGG

TTTTATAAATGTGCAATAAAAGTATTTGTTTTACCTTTGGTATGT
Translation
MTAELQQDDSAGAADGHGS - UNI2326 - - UNI16290 - SCQMLLNQLREITGIQDPSFLHEALK ASNGDITQAVSLLTDQRVKEPSHDTTAA

EPSEVEESATSKDLLAK KVIDLTHDNKDDLQAAIALSLLESPNIQADNRDLNR RAHEANSAETKRSKRKRCEVWGENHNPNNWRRVDGWPVGLKNVGN

TCWFSAVIQ SLFQLPEFRRLVLSYNLPQNILENCRSHT EKRNIMFMQELQYLFALLLGSNRKFVDPSAALDLLKGAFRSSEEQQ QDVSEFTHKLLDW

LEDAFQLAVNVN NSHLRNKSENPMVQLFYGTFLTEGVREG GKPFCNNETFGQYPLQVNGYHNLDECLEGAMVEGDIALLPSDRSVKYGQE - UNI38

86 - RWFTKLPPVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDR RYMYKSKELIRSKRESVRKLKEEIQVLQQKLER - UNI21437 - RYVK

YGSGPSRFPLPDMLKYVIEFASTKPASESCLSGSAEHVTLPLPSVHCPISDLTPKES - UNI21072 - SSSPESCSQNAGSTFSSPEDALPSSEGMN

GPFTSPHSSLETPAPPAPRTVTDEEMNFVKTCLQRWRSEIEQDIQD DLKNCISSSTKAIEQMYCDPLLRQ VPYRLHAVLVHEGQASAGHYWAYIYNQP

RQTWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMYINDNLPHFSAE EASSNESDETAGEVEALSVELRQYIQEDNWRFQQEVEEWEEEQSCKIPQM

ESSPNSSSQDFSTSQE - UNI12735 - ESPAVSSHEVRCLSSEHAVIAKEQTAQAIANTAHAYEKSGVEAALSE AFHEEYSRLYQLAKETPTSHSD

PRLQHVLVYFFQNEAPKRVVERTLLEQFADRNLSYDER - UNI30201 - RSISIMKVAQAKLMEIGPDDMNMEEYK RWHEDYSLFRKVSVYLLTGL

ELFQKGK KYQEALSYLVYAYQSNAGLLVKGPRRGVKESVIALYRRKCLL - UNI11686 - ELNAKAASLFETNDDHSVTEGINVMNELIIPCIHLI

INNDISKDDLDAIEVMRNHWCSYLGKDIAE ENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCNRFAAVMESIQGVSTVTVK

For any suggestions or comments, please send an email to unitrap@crg.es