Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032306 (Mpi)
Chromosomal location
Chr 9: 57392075 - 57400559 (-)
Description
mannose phosphate isomerase Gene [Source:MGI Symbol;Acc:MGI:97075]
RefSeq_dna
NM_025837 
RefSeq_peptide
NP_080113.1 
MGI
MGI:97075 
Uniprot/SWISSPROT
Q924M7 
Uniprot/SPTREMBL
Q3V100 Q921Z9 
Human Ortholog
ENSG00000178802 (MPI)
Omim 602579 - CONGENITAL DISORDER OF GLYCOSYLATION, TYPE Ib  
UniTrap UNI26859
Vector Insertion
Chr 9: 57400082 - 57400510
Public Clones not available
Private Clones OST90588 (lexicon) OST37546 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034856
Sequence
AACGTTCCTGAAGCCGGGTTTCAGGCAACTGGGATGGCGAGTCCGCGAG - UNI26859 - TGTTCCCACTTTCCTGTGTGGTGCAGCAGTATGCCTG

GGGGAAGGTGGGCTCCAAAAGTGAAGTGGCATGCCTGCTGGCTAGCAGTGATCCACTGGCCCAGATTTCAGAGGACAAGCCATATGCAGAG CTGTGGAT

GGGGACACACCCCCGGGGAGATGCCAAGATCCTTGACAACCGTATTTCCCAGAAGACCTTAGGCCAGTGGATTGCTGAAAACCCGGACTGCTTGGGCTCA

AAGGTCAAAAACACCTTTAATGGAAAGCTGCCCTTCCTCTTCAAAGTACTGTCAGTGGACACGGCCCTGTCTATCCAGGCACACCCTAACAAG GAGCTG

GCAGAGAAGCTGCATCTCCAGGCTCCAGAGCACTACCCTGATGCCAACCACAAGCCAGAAATGGCCATTGCCCTTACCTCCTTCCAGGGCTTGTGTGGTT

TCCGGCCAGTGGAGGAGATTGTGACCTTTATGAAGA AGGTGCCTGAGTTCCAGTTGCTGATTGGAGATGATGCCACAGCACAGCTGAAGGAGAGCGTGG

GTGGGGATACTGAGGCCATGGCTTCTGCTCTGAGGAACTGCTTTTCCCACCTGATGAAGAGTGAGAAGAAGGTGGTGGTGGAGCAGCTTAACCTGTTGGT

GAAACGGATCTCCCAGCAAG TATTTGACGGAAACAATATGGAGGACATTTATGGGAAGCTCTTGCTGCAGCTGCACCAACAGCACCCAGGTGATATCGG

ATGTTTCGCCATCTACTTCCTGAACCTGCTCACCTTGAAGCCTGGGGAAGCCATGTTTCTGGATGCCAACGTACCCCATGCCTACCTGAAGGGAG ACTG

CGTGGAATGCATGGCATGTTCGGACAATACCGTGCGTGCTGGCCTGACACCCAAATTCATTGATGTGCCAACCCTGTGTGAAATGCTCAACTACACACCT

AGCCCCAGCAACAACAGGCTGTTTGCCCCAGCACAGAGTCAAGATGACCCCTATCTCTCTATCTATGATCCTCCTGTGCCAGACTTCACTGTTATGAAGA

TGGAG GTCCCTAGCTCTGTCACTGAATACAAAGTCTCAACACTAGACTCTGCCAGCATCCTTCTGATGGTCCAAGGGACAGTGACAGCTATCATACCTT

CAGCCCATGCAGAAATCCCTCTGTACCGTGGTGGAGTGCTCTTCATTGCAGCCAATGAGAGTGTCTTACTGAAGATTACTGTGCCCAAGGATCTGCTGAT

ATTCCGGGCCTGCTGTCTGCTGTAGAGACTAGTTCTTAGTCTCTCTGCCTACCACTGTATCCTGGCCAGCTCCATATTTCAGGTGTAGCCCAATCCCTGT

CCCTGTTGTGCACTCTTTGAATGTATACTGGATTAGAAGCAGTAAATTTGGCATTAGTAACTCCAGGAGCATGCCCAGGCTGGACCATCTTCAGGACAAG

GTTTCTGTATGCATGAAGCCTGAGGCCTGCCACTCTTCTGTACCCTCTCAACACTGTTACCTCTGAGCCAGTGTGTCCACCAAAGAGGCAACCACTCTGC

CCTAGCTGAGGTGTTAGGCTAACAAAGCATGCATCCCCCAGCATTAGCTCAGCATGCTCTCAGCTGCAGAGAAGGGAAGGGAAGGGAAGGGAAGGAAGGG

AAGGGGTAGGCCAGTGGACTAATGAAGCGTATTCCCTCTAGCTCCGTCAAAGTAATTAAAGATCACTTGTGTTGAGG
Translation
MASPRV - UNI26859 - VFPLSCVVQQYAWGKVGSKSEVACLLASSDPLAQISEDKPYAE LWMGTHPRGDAKILDNRISQKTLGQWIAENPDCLGS

KVKNTFNGKLPFLFKVLSVDTALSIQAHPNK ELAEKLHLQAPEHYPDANHKPEMAIALTSFQGLCGFRPVEEIVTFMKK KVPEFQLLIGDDATAQLKE

SVGGDTEAMASALRNCFSHLMKSEKKVVVEQLNLLVKRISQQV VFDGNNMEDIYGKLLLQLHQQHPGDIGCFAIYFLNLLTLKPGEAMFLDANVPHAYL

KGD DCVECMACSDNTVRAGLTPKFIDVPTLCEMLNYTPSPSNNRLFAPAQSQDDPYLSIYDPPVPDFTVMKME VPSSVTEYKVSTLDSASILLMVQGT

VTAIIPSAHAEIPLYRGGVLFIAANESVLLKITVPKDLLIFRACCLL

For any suggestions or comments, please send an email to unitrap@crg.es