Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032313 (AI118078)
Chromosomal location
Chr 9: 55174720 - 55286151 (+)
Description
Transmembrane protein C15orf27 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q8BZB3]
RefSeq_dna
NM_172923 
RefSeq_peptide
NP_766511.1 
UniGene
Mm.24361 
MGI
MGI:2142980 
Uniprot/SWISSPROT
Q8BZB3 
Uniprot/SPTREMBL
B1B1B3 B1B1B2 
Human Ortholog
ENSG00000169758 (C15orf27)
Omim not available
UniTrap UNI30928
Vector Insertion
Chr 9: 55278272 - 55282997
Public Clones IST14891H10 (tigm) IST14754H2 (tigm) IST14918H2 (tigm) IST14877H8 (tigm)
IST14894H3 (tigm) IST14916H8 (tigm) IST14912H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085754
Sequence
GGGGTGGGGGGGCGGAGAGGGGAGCCCCGGGAGCGGGAGCGCGGGCCCGGCGCTGCAGAGCAGAGCGAATCCTGAGCTCCGGCAGCAG GGTACTCTATT

TTCATGAATCTTGTAAAAGCCCCACTTGGAAATGCTAAGATCAGACATAAGGACAGCTGAGCCCCACTAGACATCACGAAAAGCCATGGCTTTGGTTACA

TCTTTCAACATGGCCAATCCACA ACCTGCCATTGAAGGAGGAATTTCTGAAGTTGAGATTATCTCCCAACAAGTAGACGAAGAAACCAAGAGCATTGCT

CCGGTGCAGCTGGTGAACTTTGCCTATCGGGACCTGCCCCTGGCTGCCGTAGACCTCTCCACAGGGGGCTCACAGCTCCTGTCGAATTTGGACGAAGAGT

ACCAAAGAGAAGG ATGGGAAGTATGAGGGGATGGCCAAGCCTCGGAGCCATCAGATATCATCATCACCATCACCACCATCATCATTACCTTCACCATCA

CCATGATGCTATTTCAGCCACACCGTGCTTTCAG GTCTGACTGGCTGAAGCCGTGCTGTGGGAAGAGAGCAGCCGTATGGCAGGTATTTTTGCTCAGTG

CAAGTCTCAACAGTTTCCTGGTAGCCTGTGTAATATTGGTGGTGATCCTCCTGACTCTGGAGCTTCTCATAGATACAAAGCTTCTCCAGT TTTCCAATG

CTTTCCAGTTTGCTGGTGTCATTCACTGGATCAGTCTGGTCATTCTCTCTGTGTTCTTCTCAGAG ACTGTCCTACGGATCGTGGTACTGGGGATCTGGG

ATTACATCGAAAACAAAATAGAG GTGTTTGACGGGGCTGTGATCATCCTGTCCTTGGCCCCGATGGTGGCGTCCACTGTGGCTAACGGACCCAGGAGCC

CCTGGGATGCCATCAGCCTCATCATCATGTTCCGAATCTGGCGGGTGAAGAGGGTCATTGATG CCTATGTCCTGCCAGTCAAGTTGGAGATGGAGATGG

TCACCCAGCAGTATGAGAAGGCCAAGGCCATCCAAGATGAGCAGCTGGAAAGACTGACGCAAATCTGTCAGGAGCAAGGG TTTGAGATCCGGCAGCTGC

GTGCGCACCTGGCACAGCAGGACCTGGATCTGGCAGCCGAGCGGGAGGCGGCGCTGCAGGCCCCACACGTGCTCAGCCAGCCACGCAGCCGCTACAAGGT

CGTAGAGGCTGGCACGTGGGCCGAGGAGACAGCAGCCGAGAGCATCGTGGAAGAGCTGAGGCCCTCTCAAG - UNI30928 - AAGCCACAGTGAAAG

ATGACATGAACAGCTACATCAGCCAATACTACAATGGGCCCAGCAGTGGTAAGTCTGGGTTGGGACTGTTTGCATGCACTATGCAGCCCCAGGACACTTG

TGACCCCAGCAAACCCTAAACCCAAAGATAGGTACATTCTGGCCTGGCTTCAGGTAGCAGGGCCCACCATTATAAGCCTGTAGACTGTGATGGCAGAGCT

CAGGGTTAAAACACACCTGGAGCTTTAATCCTCATCTTATGGGTTAGCTGAAACCCTGACACCCTGCAGCTGCCATGGCCAGAACATCCTGATCCATCTC

TGACTGTGAGAGTTGAGTGGGGAGCCTATAAGAGGAAAGGGTTTGTAGTCCAGAACTCAAGTGATCTTCCATCCCATTCTCAGGTGGCCCTGGTGGAAAG

CAAACTTATTCAGCATAACTGGCTAAAGGGGCAGCAGGCCTTGGGTCGTCCTGATGTGCTTAATGCTCCCTTCATACCCTTGAAATCCTCGAGGGTGCCT

AGGGGGTCGGGGGTGGGGGTGGGGAGGGAGATTGATTGCATACCCAGACCTGTTATCATACTGGTTTTCAGTAGCCAAAGTTTCAAACCTTGAGTTTGGA

TTTTACAGTCCTTGAAATTCTTGCACTCTCCACTATAGGCATAGAAAATATATGCTACCTAACACGTATTTGATTGTTTTTCTTCTCCACTGTCTAGCCC

CCTAAGACCAGTTCTCTCTTTTCTCCTTTCCCTTGTCCTCATCTAAACTGCTGGTTCTCCAGCTCTCACCCTTTTTCTCAGTCCTCTCCCCATAACTTTG

GGGAGAGCCCTGTAGCTCTACAGCCAGCGTACTCTACCATCAGCCCCACTGCCTCTCAGAGAAAAGAGCTGCTATGCGCTGAGAGCCCTGAGGGCAGTCA

GTCTTCAGAAAACAGACCACTCAGGACACATACCACACTCCTCCAGCCCATTTAAAACTCCCAAGAGTGTGGCAAGGTGGAACTCAGGGGTTCTCTGGGT

AGCCAGCTGGCAAATTCCAGTCTCTAGGAGAGATCCTGTCTCAACTCAACCCCTGGCCCCACTCACATATGGGCAGGTGCTCCCATACTCATGAGCATGC

ACACATCAACTACTACCACTACCACTAATAATAATTATAATAATAATAATTAATAATAACTCAGTCACTCCTCAAGAGAACCCCAATCCATTCTCCTGGG

GCAAGCTTTCTGGGTTGATTGGGATGGACTAGGTTGGTCTATTGTGAAGATATTTCTTCATCTTGGCTTAAAAGGCCCACATGTGAGGCTCTCCTCCCAG

ACCATTTCTACCACCCAGAAACCAGCAGTCCTCACTGAGTACAAGGTGGACCTCGAGGCCAAAGCACTAGCTGAGAAGTGCTTCCACTGAGAAGCACTTC

TATCGGGAAGTGTTGTGGGTCCCGATTCATGGGTGACTGGTAAAAGAATGTCACATGTCTGCACTTCAGTTCACCGAGGGGAACTGGCAACATTTCCCTC

AGTTTAAGCAATGATCATGGCCTAGGTTCTCAGACTGCCCTTCATCATGACCTAGATTCTCGAAGACTGCTCTTTACCATGGCTGCTTCTGACACCTAGC

AACACTTCTGTTGCCGGCACCTCTCTGGCCTTCAAAGTGACGGAGGCAAAGTGTGATCAATATAACCTTTCTTAGTGGGGCAAACACCTTTAATTTCAAC

ACTCAGGAGGCAAAAGCAGGCAGACCTCTGTGAGTTCAAGGCCAGCCTCGTCTACAGAGTGATTTCCAGGATACCTATCAGCGCTACAAAGTGAAACCCT

GTCTCAAAAAACAAAACAACAAATCACACACACATGTATGTATGTATGTATGTATGTATGTATGTATGTATGTATATATGTATGTATGTTATTTCTTGCA

GACAGTGGAGCCCCAGAACCAGCAGTATGTGTGGTCACTACAGCTGCCATAGACATCCACCAGCCCAATGTCCCCTCAGACCTCTTCTCAGTCGACCTGC

CTCTGAAGCTCAGTGGCAACAGCACCTGCGCCAGCGCCACCTCGGAGACCACCTCCCACTCTACCTGTGGCTCAGTCACCAGGGCCCAGAGTGCCAGCAG

CCAGACACTGGGTTCCTCCACAGACTGTAGCACCCCCCGGGAAGAGCTGCTGCCCTCTAAGCCCAGATCTTCTCCCCTGCCACTGCTTCTGCCCCCTCAG

CAGCTGGTGGCAGAGGCCACAGTCCAGGACCTGATGTCCTCTCTGTCAAAGGACCCCTGCCCATCCCATAAGGCCTTGGACCCAGCACCCCTGGCCCAGC

CTACCCCACTGGGCTCAGTCCAGACCAGCCCTGAGCTGGAGCATAGGGTGAGTCTGTTCAACCAGAAGAACCAGGAGGCTCTCCCTGTTCTTCAGATCAA

CCCTGTCATCCACTTGCAGCCCACAGCGGGGCTGGAGGAGAAGTTCAGATCTTTGGAATCCAAAGAGCCAAAGTTGCATACAGTTCCTGAGGCCTAGAGA

GCCTACTGGCTTGTTGAGTGCAAAGAGGGGAGACAGCCATCTTGGTACTTCAGGACCCCAGAGGCCACCCACGGCCATACAAGGGGCTCAGGATCCCATC

TGATCTCCCACAGGGTGCTGTCTGCCTCCAGGGAGGTGACGCCAGGCAGAGGCCACATGCCTCAGACCTCAGTCAGAGTCCAGAGCTGGGGCCTCCTTTT

GCCCTACTCAGGAGAGGGTGGTGCTCCTGGCTGGGGTTTTGGGTTTTTGTTTTATTTGTTGTATTGTTTTGTTTTTTAAAACCATTTTTATAAAAACCAG

CCTATGGCCCAGCTTCAGCAGGGTAGAGTGTGGGGGCCAGCTCAGCCTCTTTCGTTGCCTTCGTTCCTGATGCCCACCCCGGATTCTCGGGGACAGCACT

GTGAGCAGGGGCTGCACAGCCTCACCCCAAGCCGTCTTTCCAGAAATGCTGAGGGAGCCGCCACAACCACGGAGACCACACCCGAGCCTGTCTCACCTGC

CATTCTCTCATTCCAGCATGGACATTTCCAAGTCTTCACAGGCCATGAGGGGATGGATCTGGAAGCGGGAGGGGGATGGGAGGGGAGGGACAGCCATTTT

ATGACCCTGGCTTTAATAATAAAAACCAGCTGCACTG
Translation
   MMLFQPHRAFR RSDWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDTKLLQF FSNAFQFAGVIHWISLVILSVFFSE TVLRI

VVLGIWDYIENKIE VFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMFRIWRVKRVIDA AYVLPVKLEMEMVTQQYEKAKAIQDEQLERLTQICQE

QG FEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRYKVVEAGTWAEETAAESIVEELRPSQE - UNI30928 - EATVKDDMNSYISQYYNGP

SSGKSGLGLFACTMQPQDTCDPSKP
Transcript ENSMUST00000034862
Sequence
GAGCGCGGGCCCGGCGCTGCAGAGCAGAGCGAATCCTGAGCTCCGGCAGCAG GGTACTCTATTTTCATGAATCTTGTAAAAGCCCCACTTGGAAATGCT

AAGATCAGACATAAGGACAGCTGAGCCCCACTAGACATCACGAAAAGCCATGGCTTTGGTTACATCTTTCAACATGGCCAATCCACA ACCTGCCATTGA

AGGAGGAATTTCTGAAGTTGAGATTATCTCCCAACAAGTAGACGAAGAAACCAAGAGCATTGCTCCGGTGCAGCTGGTGAACTTTGCCTATCGGGACCTG

CCCCTGGCTGCCGTAGACCTCTCCACAGGGGGCTCACAGCTCCTGTCGAATTTGGACGAAGAGTACCAAAGAGAAGG GTCTGACTGGCTGAAGCCGTGC

TGTGGGAAGAGAGCAGCCGTATGGCAGGTATTTTTGCTCAGTGCAAGTCTCAACAGTTTCCTGGTAGCCTGTGTAATATTGGTGGTGATCCTCCTGACTC

TGGAGCTTCTCATAGATACAAAGCTTCTCCAGT TTTCCAATGCTTTCCAGTTTGCTGGTGTCATTCACTGGATCAGTCTGGTCATTCTCTCTGTGTTCT

TCTCAGAG ACTGTCCTACGGATCGTGGTACTGGGGATCTGGGATTACATCGAAAACAAAATAGAG GTGTTTGACGGGGCTGTGATCATCCTGTCCTTG

GCCCCGATGGTGGCGTCCACTGTGGCTAACGGACCCAGGAGCCCCTGGGATGCCATCAGCCTCATCATCATGTTCCGAATCTGGCGGGTGAAGAGGGTCA

TTGATG CCTATGTCCTGCCAGTCAAGTTGGAGATGGAGATGGTCACCCAGCAGTATGAGAAGGCCAAGGCCATCCAAGATGAGCAGCTGGAAAGACTGA

CGCAAATCTGTCAGGAGCAAGGG TTTGAGATCCGGCAGCTGCGTGCGCACCTGGCACAGCAGGACCTGGATCTGGCAGCCGAGCGGGAGGCGGCGCTGC

AGGCCCCACACGTGCTCAGCCAGCCACGCAGCCGCTACAAGGTCGTAGAGGCTGGCACGTGGGCCGAGGAGACAGCAGCCGAGAGCATCGTGGAAGAGCT

GAGGCCCTCTCAAG - UNI30928 - AAGCCACAGTGAAAGATGACATGAACAGCTACATCAGCCAATACTACAATGGGCCCAGCAGTG ACAGTGGA

GCCCCAGAACCAGCAGTATGTGTGGTCACTACAGCTGCCATAGACATCCACCAGCCCAATGTCCCCTCAGACCTCTTCTCAGTCGACCTGCCTCTGAAGC

TCAGTGGCAACAGCACCTGCGCCAGCGCCACCTCGGAGACCACCTCCCACTCTACCTGTGGCTCAGTCACCAGGGCCCAGAGTGCCAGCAGCCAGACACT

GGGTTCCTCCACAGACTGTAGCACCCCCCGGGAAGAGCTGCTGCCCTCTAAGCCCAGATCTTCTCCCCTGCCACTGCTTCTGCCCCCTCAGCAGCTGGTG

GCAGAGGCCACAGTCCAGGACCTGATGTCCTCTCTGTCAAAGGACCCCTGCCCATCCCATAAGGCCTTGGACCCAGCACCCCTGGCCCAGCCTACCCCAC

TGGGCTCAGTCCAGACCAGCCCTGAGCTGGAGCATAGGGTGAGTCTGTTCAACCAGAAGAACCAGGAGGCTCTCCCTGTTCTTCAGATCAACCCTGTCAT

CCACTTGCAGCCCACAGCGGGGCTGGAGGAGAAGTTCAGATCTTTGGAATCCAAAGAGCCAAAGTTGCATACAGTTCCTGAGGCCTAGAGAGCCTACTGG

CTTGTTGAGTGCAAAGAGGGGAGACAGCCATCTTGGTACTTCAGGACCCCAGAGGCCACCCACGGCCATACAAGGGGCTCAGGATCCCATCTGATCTCCC

ACAGGGTGCTGTCTGCCTCCAGGGAGGTGACGCCAGGCAGAGGCCACATGCCTCAGACCTCAGTCAGAGTCCAGAGCTGGGGCCTCCTTTTGCCCTACTC

AGGAGAGGGTGGTGCTCCTGGCTGGGGTTTTGGGTTTTTGTTTTATTTGTTGTATTGTTTTGTTTTTTAAAACCATTTTTATAAAAACCAGCCTATGGCC

CAGCTTCAGCAGGGTAGAGTGTGGGGGCCAGCTCAGCCTCTTTCGTTGCCTTCGTTCCTGATGCCCACCCCGGATTCTCGGGGACAGCACTGTGAGCAGG

GGCTGCACAGCCTCACCCCAAGCCGTCTTTCCAGAAATGCTGAGGGAGCCGCCACAACCACGGAGACCACACCCGAGCCTGTCTCACCTGCCATTCTCTC

ATTCCAGCATGGACATTTCCAAGTCTTCACAGGCCATGAGGGGATGGATCTGGAAGCGGGAGGGGGATGGGAGGGGAGGGACAGCCATTTTATGACCCTG

GCTTTAATAATAAAAACCAGCTGCACTGAG
Translation
 MALVTSFNMANPQ QPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTGGSQLLSNLDEEYQREG GSDWLKPCCGKRAAVWQVFL

LSASLNSFLVACVILVVILLTLELLIDTKLLQF FSNAFQFAGVIHWISLVILSVFFSE TVLRIVVLGIWDYIENKIE VFDGAVIILSLAPMVASTVA

NGPRSPWDAISLIIMFRIWRVKRVIDA AYVLPVKLEMEMVTQQYEKAKAIQDEQLERLTQICQEQG FEIRQLRAHLAQQDLDLAAEREAALQAPHVLS

QPRSRYKVVEAGTWAEETAAESIVEELRPSQE - UNI30928 - EATVKDDMNSYISQYYNGPSSD DSGAPEPAVCVVTTAAIDIHQPNVPSDLFSV

DLPLKLSGNSTCASATSETTSHSTCGSVTRAQSASSQTLGSSTDCSTPREELLPSKPRSSPLPLLLPPQQLVAEATVQDLMSSLSKDPCPSHKALDPAPL

AQPTPLGSVQTSPELEHRVSLFNQKNQEALPVLQINPVIHLQPTAGLEEKFRSLESKEPKLHTVPEA

For any suggestions or comments, please send an email to unitrap@crg.es