Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032316 (Clk3)
Chromosomal location
Chr 9: 57598518 - 57613324 (-)
Description
CDC-like kinase 3 Gene [Source:MGI Symbol;Acc:MGI:1098670]
RefSeq_dna
NM_007713 
RefSeq_peptide
NP_031739.3 
MGI
MGI:1098670 
Uniprot/SWISSPROT
O35492 
Uniprot/SPTREMBL
Q3UWB8 Q9QXE3 
Human Ortholog
ENSG00000179335 (CLK3)
Omim not available
UniTrap UNI31779
Vector Insertion
Chr 9: 57609522 - 57613325
Public Clones (sanger) IST14678D2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37702
Vector Insertion
Chr 9: 57606433 - 57608848
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065330
Sequence
ATGCCGGTCCTCTCCGCGCGCAGGAAGAGGCTGGCGAGCACAGCTGGGCCGCGGCGGGGAAGCGGCCCCAGCCTGGCAGTCCGGTGGGTTCCTCCTTTAG

GCCCAGAGCCGTCCTCAGACCGTGGTCGCGCACCGATGCGGCCTCGGGGGCCTACGTGCAGCACCACACGGAGAGGGGCAGGCCGCGGCCCGAGGCTGCT

CCCGGGACCTCCGGGAAGAGACCTCCACCGATGTCGCCCGGACCCTGGCGGGGCAGGCCAGTCCCCCAGAGTCTGCGAGTTCGGGGCTAGAGCGGTCAGG

CCTCTGGGCCGGGTCGAGCCCGGGCCGCCGACGGCTGCGTCACGCGAGGGGGCGGTGCTGCCACGGGCGGAGGCCAGAGCCGGAAGCGGAAGAGGCGCTC

GGAGTGGGGAGTGGGGCCTAGCCGCAGCCGGAGCCTGGGAGACG - UNI31779 - ATGCATCACTGTAAGCGATACCGTTCCCCAGAGCCAGACCCA

TACCTGAGCTACCGCTGGAAGAGGAGGCGGTCTTACAGTCGGGAGCATGAAGGTCGACTACGATACCCATCCCGAAGGGAGCCTCCCCCACGGAGATCAC

GGTCCAGAAG - UNI31779 - CCATGATCGTATACCCTACCAGCGGAGGTACCGGGAACACCGTGACAGTGATACGTATCGGTGTGAAGAGCGGAGC

CCATCTTTTGGAGAGGACTGCTATGGGTCTTCACGTTCTCGACATCGGAGACGGTCACGAGAGAGGGCGCCGTACCGTACCCGCAAGCATGCCCACCACT

GTCACAAACGCCGTACCAGGTCTTGTAGCAGTGCTTCCTCG AGAAGCCAACAGAGCAGTAAGCGCAGCAGCCGGAGTGTGGAAGATGACAAGGAGGGCC

ACCTGGTGTGCCGGATCGGCGATTGGCTCCAAGAGCGAT ATGAGATCGTGGGGAACCTGGGTGAAGGCACCTTTGGCAAGGTGGTGGAGTGCTTGGACC

ATGCCAG AGGGAAGTCACAGGTTGCCCTGAAGATCATCCGTAATGTGGGCAAGTATCGGGAAGCTGCTCGTCTAGAAATTAATGTTCTCAAGAAAATCA

AGGAGAAAGACAAGGAAAATAAGTT CCTTTGTGTCCTGATGTCTGACTGGTTCAACTTCCATGGTCATATGTGCATCGCCTTTGAGCTCCTGGGCAAGA

ACACCTTTGAGTTCCTGAAGGAGAACAACTTCCAGCCTTACCCCCTACCACATGTCCGGCACATGGCCTACCAGCTCTGTCATGCCCTTAGAT TTCTAC

ACGAGAACCAGCTGACCCACACAGACTTGAAGCCAGAGAACATCTTGTTTGTGAATTCTGAGTTTGAAACCCTCTACAATGAGCACAAG AGCTGCGAGG

AGAAGTCAGTGAAGAACACCAGCATCCGAGTGGCAGACTTTGGCAGTGCCACGTTTGACCATGAACATCACACCACCATTGTGGCCACCCGTCACTACCG

CCCACCTGAGGTGATCCTTG AGCTGGGCTGGGCACAGCCCTGTGATGTCTGGAGTATCGGCTGCATTCTCTTTGAGTACTACCGTGGCTTTACACTCTT

CCAG ACCCATGAAAATAGAGAACACTTGGTTATGATGGAGAAGATTCTAGGACCCATCCCATCACACATGATCCACCGTACCAG GAAGCAGAAATATT

TCTACAAAGGGGGCCTGGTTTGGGATGAGAACAGCTCTGATGGGCGGTATGTGAAGGAGAACTGCAAACCTCTGAAG AGTTACATGCTGCAGGACTCCC

TGGAGCATGTGCAGCTGTTTGACCTGATGAGGAGGATGTTAGAGTTCGACCCTGCTCAGCGCATCACATTGGCAGAAGCCTTGCTGCACCCCTTCTTTGC

TGGCCTGACCCCTGAGGAGCGGTCCTTCCACAGCAGCCGTAACCCCAGCAGATGACAGGTGCAGGCCAGCACACGAAGAGTTGGAGAGCTGGACTGGGCT

GCTGGCCCCTTTTCTCCAGCCTCTCCCACTGGCCTCAGAGCCAGAGCCACCGATGAACAGTGCAATGTGAAGGAAGGCAGGAGCCTGCAAGGGAAGGGGG

AATGTGGTGCCCGGCTGCCAGAAAGCACAGATTGGACCCAAGCTATTTATATGTTGTAAAGTTATAATAAAGTGTTTCTTACTGTTTGT
Translation
MPVLSARRKRLASTAGPRRGSGPSLAVRWVPPLGPEPSSDRGRAPMRPRGPTCSTTRRGAGRGPRLLPGPPGRDLHRCRPDPGGAGQSPRVCEFGARAVR

PLGRVEPGPPTAASREGAVLPRAEARAGSGRGARSGEWGLAAAGAWET - UNI31779 - MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPS

RREPPPRRSRSRS - UNI31779 - SHDRIPYQRRYREHRDSDTYRCEERSPSFGEDCYGSSRSRHRRRSRERAPYRTRKHAHHCHKRRTRSCSSASS

 RSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERY YEIVGNLGEGTFGKVVECLDHAR RGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKF 

FLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALRF FLHENQLTHTDLKPENILFVNSEFETLYNEHK SCEEKSVKN

TSIRVADFGSATFDHEHHTTIVATRHYRPPEVILE ELGWAQPCDVWSIGCILFEYYRGFTLFQ THENREHLVMMEKILGPIPSHMIHRTR RKQKYFY

KGGLVWDENSSDGRYVKENCKPLK SYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSFHSSRNPSR

For any suggestions or comments, please send an email to unitrap@crg.es