Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032327 (Stra6)
Chromosomal location
Chr 9: 57976895 - 58001762 (+)
Description
stimulated by retinoic acid gene 6 Gene [Source:MGI (curated);Acc:Stra6-001]
RefSeq_dna
NM_009291 
RefSeq_peptide
NP_033317.1 
UniGene
Mm.10801 
MGI
MGI:107742 
Uniprot/SWISSPROT
O70491 
Uniprot/SPTREMBL
Q8C442 
Human Ortholog
ENSG00000137868 (STRA6)
Omim 601186 - MICROPHTHALMIA, SYNDROMIC 9  
UniTrap UNI22462
Vector Insertion
Chr 9: 57977489 - 57982880
Public Clones not available
Private Clones OST296333 (lexicon) OST277697 (lexicon) OST276762 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21359
Vector Insertion
Chr 9: 57983010 - 57986786
Public Clones IST14802D3 (tigm)
Private Clones OST333389 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36689
Vector Insertion
Chr 9: 57989030 - 57990721
Public Clones IST12127F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034880
Sequence
GCTCAGGGGCACAGAGCTAAGCAGACAGGAGGGGGTAGGCCCCGCTAACTCCAGAGGTCTAGGTCTGGGAGGGGGCTGCTTTCCAGGAGATCAAACAGTG

GTTCTTAAAGCAGGTGTGGGGACCCTGCTCAGTACAACTACTGCGGCCTCACAACCAGCCAGCCTCCGGGATCCCAGCTCTGACAAAGCTGAGACCCAGA

AAAGAAGGCTCTAGTTGGTCAGGAGCACTCTGCCGCGTCTCCCCAGATCGGTCAAGGAAGGGGAAGAGGTCCGGAAGGGGAAACCAAGGAAGCCTGCAAG

GTGAATTGGGCTGGAGCCAACCTGGAAAGTTAG - UNI22462 - GAAGAAGAGCTGGAGCATGGAGTCCCAGGCATCTGAGAATGGAAGCCAGACCT

CCTCCGGGGTGACAGATGACTACAGCAGCTGGTACATCGAGGAACCTCTAGGAGCTGAGGAGGTGCAGCCAGAGGG - UNI21359 - GGTGATTCCC

CTTTGCCAGCTCACCGCACCCCCTGCCCTGCTCCATGCCTGCCTGGCTTCACTGTCG TTCCTGGTTCTGCTGCTGCTGGCCTTGCTGGTGAGACGGCGC

AGGCTTTGGCCACGCTGTGGTCATCGCGGACTTGGACTGCCCAG CCCTGTGGATTTCTTGGCTGGGGACCTATCCTGGACAGTGCCTGCTGCTGTCTTT

GTGGTCCTCTTCAGCAACCTATGCCTGTTGCTCCCTGATGAGAACCCACTGCCTTTCCTGAACCTCACTGCAGCATCAAGTCCAG ATGGAGAGATGGAG

ACATCAAGAG GGCCCTGGAAGCTACTGGCTCTGCTCTACTATCCAGCCCTCTATTACCCTCTGGCTGCTTGTGCTTCGGCAGGGCACCAAGCTGCATTC

CTATTGGGTACTGTGTTATCTTGGGCCCACTTTGGTGTTCAGGTCTGGCAGAAAGCTGAGTGTCCTCAGGATCCTAAG - UNI36689 - ATCTACAA

GCACTACTCCTTGCTGGCCTCCCTGCCTCTACTTCTGGGTCTTGGATTCCTGAGCCTTTGGTATCCAGTACAACTTGTGCAGAGTCTCCGTCACCCGACA

GGAGCAGGCTCCCAG GGGCTGCAGACCAGCTACTCCGAGAAGTATCTGAGAACTCTTCTCTGCCCAAAGAAGTTGGATAGCTG CTCCCATCCTGCCTC

CAAGCGTAGCCTCCTGTCTCGGGCCTGGGCCTTCTCCCATCATTCCATCTACACTCCACAGCCAG GATTCCGCCTGCCCTTGAAGCTGGTGATCTCGGC

CACCCTGACAGGAACAGCCACTTACCAG GTGGCCCTGCTGCTGCTGGTGAGCGTGGTGCCTACTGTGCAGAAGGTGAGGGCGGGGATCAACACAGATGT

CTCCTACCTGCTGGCTGGCTTTGGGATCGTGCTCTCTGAAGACAGGCAGGAGGTGGTAGAGCTGGTGAAGCATCACCTATGGACTGTGGAAG CATGCTA

CATCTCAGCTCTGGTCTTGTCCTGCGCATCAACCTTCCTGCTCCTGATCCGATCCCTGAGGACACACAG GGCCAATCTTCAAGCACTACACCGAGGGGC

TGCCCTGGATCTGGACCCCCCTCTTCAGAGTATTCATCCCTCTCGCCAAGCCATAGTCAGCTGGATGAGCTTCTGTGCCTACCAGACGGCCTTCAGCTGC

CTTG GGCTCCTGGTGCAGCAGGTCATCTTCTTCTTGGGGACCACATCCCTGGCCTTCCTGGTGTTTGTGCCTTTACTGCATGGCAGGAACCTCCTGCTG

CTGCGATCCCTGGAATCCACGTG GCCCTTCTGGCTGACTGTGGCCTTAGCTGTAATCCTGCAGAACATAGCAGCCAACTGGATCTTCCTGAGGACTCAC

CATGGATACCCAGAGCTGACCAACCG GCGCATGCTCTGCGTAGCTACTTTTCTCCTCTTCCCCATCAACATGCTGGTGGGAGCCATAATGGCTGTCTGG

CGGGTGCTCATCTCTTCTCTCTACAACACTGTTCACCTCGGCCAGATGGACCTCAGCCTGCTGCCGCAGAGGGCAGCCTCCCTGGATCCAG GCTACCAC

ACATACCAAAACTTCCTGAGGATTGAGGCCAGCCAGTCACATCCAGGAGTCATAGCCTTCTGTGCCCTGCTCCTCCATGCTCCAAGTCCACAGCCCCGGC

CCCCATTGGCCCCTCAGGACAGCCTCAGGCCGGCAGAAGAAGAAGAAG GGATGCAGTTGCTACAGACCAAGGACCTGATGGCCAAGGGAGCAGGACACA

AAGGCAGCCAGAGCAGGGCCCGCTGGGGTCTGGCCTACACATTGCTCCACAATCCAAGCCTACAGGCCTTCCGGAAGGCAGCCCTTACTAGTGCCAAGGC

CAATGGCACCCAGCCCTGAGGGTGAAGAAAACCACATCACCCTGCCTTTATGTGCTGAGGCACATTCCTGTCTCCCATCCTCCCTCCCATTCATGTCTGC

AACCCCCTCGCCCCAGCAGCAGCTCTGCCAGCCAGCTGATCCCTGTGGGATCAGGGGACTGGAGTCACTGTGTCTACACCACCAGCTTCTAGAGGAATTT

GGTCTATGCTTGTCCACCAGGCTACCAGCTAGGGCTCTAGAGAAAGCAGCTAGTGGTTTCTTTGTCTTGGAACAGGCAGGGTAAGGGTGGGCACATTTAG

GCCTCTTCTCCTCACACTGGCCCTGCCATCAGCTTTTGGGGCCTCAGCAAGGCCTCTCTTTCTCCCCGTTGGTGATGAAAGGCCTGAATATCTCCCATCC

CAGCTGGCCCCACCTCAGCCCCAGCCCTCCCACCATGAAAGTGGAACCTGTGTGGGCTTCCTCTCTGCCCCAGATCTCTCCTTCCTCTCTCTTCCTTCCA

CTCCCGCCCCTTCTCTTGCAGCCAAGTCAGACTCCAAGAGGCCCCACTGAGCTGCCCTCTCCAAAAACCAGATTTTTTTTTGTAGTTTTAATGCCATTAG

TTGTCATGAAAGAAGTTAGTGTGCTCTCTGTAATAAATGTGCCTCTGAGG
Translation
 - UNI22462 - MESQASENGSQTSSGVTDDYSSWYIEEPLGAEEVQPEG - UNI21359 - GVIPLCQLTAPPALLHACLASLS FLVLLLLALL

VRRRRLWPRCGHRGLGLPS SPVDFLAGDLSWTVPAAVFVVLFSNLCLLLPDENPLPFLNLTAASSPD DGEMETSRG GPWKLLALLYYPALYYPLAAC

ASAGHQAAFLLGTVLSWAHFGVQVWQKAECPQDPK - UNI36689 - IYKHYSLLASLPLLLGLGFLSLWYPVQLVQSLRHPTGAGSQ GLQTSYSEK

YLRTLLCPKKLDSC CSHPASKRSLLSRAWAFSHHSIYTPQPG GFRLPLKLVISATLTGTATYQ VALLLLVSVVPTVQKVRAGINTDVSYLLAGFGIV

LSEDRQEVVELVKHHLWTVEA ACYISALVLSCASTFLLLIRSLRTHR RANLQALHRGAALDLDPPLQSIHPSRQAIVSWMSFCAYQTAFSCLG GLLV

QQVIFFLGTTSLAFLVFVPLLHGRNLLLLRSLESTW WPFWLTVALAVILQNIAANWIFLRTHHGYPELTNR RRMLCVATFLLFPINMLVGAIMAVWRV

LISSLYNTVHLGQMDLSLLPQRAASLDPG GYHTYQNFLRIEASQSHPGVIAFCALLLHAPSPQPRPPLAPQDSLRPAEEEEG GMQLLQTKDLMAKGAG

HKGSQSRARWGLAYTLLHNPSLQAFRKAALTSAKANGTQP
Transcript ENSMUST00000085677
Sequence
CTGGACTCAGTACAATTCATCAGGCGATACCCCCCTGGGAGTGATGGATAGTGACAAATGAGG - UNI22462 - GAAGAAGAGCTGGAGCATGGAGT

CCCAGGCATCTGAGAATGGAAGCCAGACCTCCTCCGGGGTGACAGATGACTACAGCAGCTGGTACATCGAGGAACCTCTAGGAGCTGAGGAGGTGCAGCC

AGAGGG - UNI21359 - GGTGATTCCCCTTTGCCAGCTCACCGCACCCCCTGCCCTGCTCCATGCCTGCCTGGCTTCACTGTCG TTCCTGGTTCTG

CTGCTGCTGGCCTTGCTGGTGAGACGGCGCAGGCTTTGGCCACGCTGTGGTCATCGCGGACTTGGACTGCCCAG CCCTGTGGATTTCTTGGCTGGGGAC

CTATCCTGGACAGTGCCTGCTGCTGTCTTTGTGGTCCTCTTCAGCAACCTATGCCTGTTGCTCCCTGATGAGAACCCACTGCCTTTCCTGAACCTCACTG

CAGCATCAAGTCCAG ATGGAGAGATGGAGACATCAAGAG GGCCCTGGAAGCTACTGGCTCTGCTCTACTATCCAGCCCTCTATTACCCTCTGGCTGCT

TGTGCTTCGGCAGGGCACCAAGCTGCATTCCTATTGGGTACTGTGTTATCTTGGGCCCACTTTGGTGTTCAGGTCTGGCAGAAAGCTGAGTGTCCTCAGG

ATCCTAAG - UNI36689 - ATCTACAAGCACTACTCCTTGCTGGCCTCCCTGCCTCTACTTCTGGGTCTTGGATTCCTGAGCCTTTGGTATCCAGTA

CAACTTGTGCAGAGTCTCCGTCACCCGACAGGAGCAGGCTCCCAG GGGCTGCAGACCAGCTACTCCGAGAAGTATCTGAGAACTCTTCTCTGCCCAAAG

AAGTTGGATAGCTG CTCCCATCCTGCCTCCAAGCGTAGCCTCCTGTCTCGGGCCTGGGCCTTCTCCCATCATTCCATCTACACTCCACAGCCAG GATT

CCGCCTGCCCTTGAAGCTGGTGATCTCGGCCACCCTGACAGGAACAGCCACTTACCAG GTGGCCCTGCTGCTGCTGGTGAGCGTGGTGCCTACTGTGCA

GAAGGTGAGGGCGGGGATCAACACAGATGTCTCCTACCTGCTGGCTGGCTTTGGGATCGTGCTCTCTGAAGACAGGCAGGAGGTGGTAGAGCTGGTGAAG

CATCACCTATGGACTGTGGAAG CATGCTACATCTCAGCTCTGGTCTTGTCCTGCGCATCAACCTTCCTGCTCCTGATCCGATCCCTGAGGACACACAG 

GGCCAATCTTCAAGCACTACACCGAGGGGCTGCCCTGGATCTGGACCCCCCTCTTCAGAGTATTCATCCCTCTCGCCAAGCCATAGTCAGCTGGATGAGC

TTCTGTGCCTACCAGACGGCCTTCAGCTGCCTTG GGCTCCTGGTGCAGCAGGTCATCTTCTTCTTGGGGACCACATCCCTGGCCTTCCTGGTGTTTGTG

CCTTTACTGCATGGCAGGAACCTCCTGCTGCTGCGATCCCTGGAATCCACGTG GCCCTTCTGGCTGACTGTGGCCTTAGCTGTAATCCTGCAGAACATA

GCAGCCAACTGGATCTTCCTGAGGACTCACCATGGATACCCAGAGCTGACCAACCG GCGCATGCTCTGCGTAGCTACTTTTCTCCTCTTCCCCATCAAC

ATGCTGGTGGGAGCCATAATGGCTGTCTGGCGGGTGCTCATCTCTTCTCTCTACAACACTGTTCACCTCGGCCAGATGGACCTCAGCCTGCTGCCGCAGA

GGGCAGCCTCCCTGGATCCAG GCTACCACACATACCAAAACTTCCTGAGGATTGAGGCCAGCCAGTCACATCCAGGAGTCATAGCCTTCTGTGCCCTGC

TCCTCCATGCTCCAAGTCCACAGCCCCGGCCCCCATTGGCCCCTCAGGACAGCCTCAGGCCGGCAGAAGAAGAAGAAG GGATGCAGTTGCTACAGACCA

AGGACCTGATGGCCAAGGGAGCAGGACACAAAGGCAGCCAGAGCAGGGCCCGCTGGGGTCTGGCCTACACATTGCTCCACAATCCAAGCCTACAGGCCTT

CCGGAAGGCAGCCCTTACTAGTGCCAAGGCCAATGGCACCCAGCCCTGAGGGTGAAGAAAACCACATCACCCTGCCTTTATGTGCTGAGGCACATTCCTG

TCTCCCATCCTCCCTCCCATTCATGTCTGCAACCCCCTCGCCCCAGCAGCAGCTCTGCCAGCCAGCTGATCCCTGTGGGATCAGGGGACTGGAGTCACTG

TGTCTACACCACCAGCTTCTAGAGGAATTTGGTCTATGCTTGTCCACCAGGCTACCAGCTAGGGCTCTAGAGAAAGCAGCTAGTGGTTTCTTTGTCTTGG

AACAGGCAGGGTAAGGGTGGGCACATTTAGGCCTCTTCTCCTCACACTGGCCCTGCCATCAGCTTTTGGGGCCTCAGCAAGGCCTCTCTTTCTCCCCGTT

GGTGATGAAAGGCCTGAATATCTCCCATCCCAGCTGGCCCCACCTCAGCCCCAGCCCTCCCACCATGAAAGTGGAACCTGTGTGGGCTTCCTCTCTGCCC

CAGATCTCTCCTTCCTCTCTCTTCCTTCCACTCCCGCCCCTTCTCTTGCAGCCAAGTCAGACTCCAAGAGGCCCCACTGAGCTGCCCTCTCCAAAAACCA

GATTTTTTTTTGTAGTTTTAATGCCATTAGTTGTCATGAAAGAAGTTAGTGTGCTCTCTGTAATAAATGTGCCTCTGAGGAA
Translation
 - UNI22462 - MESQASENGSQTSSGVTDDYSSWYIEEPLGAEEVQPEG - UNI21359 - GVIPLCQLTAPPALLHACLASLS FLVLLLLALL

VRRRRLWPRCGHRGLGLPS SPVDFLAGDLSWTVPAAVFVVLFSNLCLLLPDENPLPFLNLTAASSPD DGEMETSRG GPWKLLALLYYPALYYPLAAC

ASAGHQAAFLLGTVLSWAHFGVQVWQKAECPQDPK - UNI36689 - IYKHYSLLASLPLLLGLGFLSLWYPVQLVQSLRHPTGAGSQ GLQTSYSEK

YLRTLLCPKKLDSC CSHPASKRSLLSRAWAFSHHSIYTPQPG GFRLPLKLVISATLTGTATYQ VALLLLVSVVPTVQKVRAGINTDVSYLLAGFGIV

LSEDRQEVVELVKHHLWTVEA ACYISALVLSCASTFLLLIRSLRTHR RANLQALHRGAALDLDPPLQSIHPSRQAIVSWMSFCAYQTAFSCLG GLLV

QQVIFFLGTTSLAFLVFVPLLHGRNLLLLRSLESTW WPFWLTVALAVILQNIAANWIFLRTHHGYPELTNR RRMLCVATFLLFPINMLVGAIMAVWRV

LISSLYNTVHLGQMDLSLLPQRAASLDPG GYHTYQNFLRIEASQSHPGVIAFCALLLHAPSPQPRPPLAPQDSLRPAEEEEG GMQLLQTKDLMAKGAG

HKGSQSRARWGLAYTLLHNPSLQAFRKAALTSAKANGTQP

For any suggestions or comments, please send an email to unitrap@crg.es