Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032330 (Cox7a2)
Chromosomal location
Chr 9: 79603215 - 79607520 (-)
Description
cytochrome c oxidase, subunit VIIa 2 Gene [Source:MGI Symbol;Acc:MGI:1316715]
RefSeq_dna
NM_009945 
RefSeq_peptide
NP_034075.2 
UniGene
Mm.152627 Mm.463962 
MGI
MGI:1316715 
Uniprot/SWISSPROT
P48771 
Human Ortholog
ENSG00000112695 (COX7A2)
Omim not available
UniTrap UNI19547
Vector Insertion
Chr 9: 79606387 - 79607446
Public Clones IST12314C5 (tigm)
Private Clones OST389077 (lexicon) OST389075 (lexicon) OST257245 (lexicon) OST248561 (lexicon)
OST225655 (lexicon) OST179121 (lexicon) OST57311 (lexicon) OST39071 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20696
Vector Insertion
Chr 9: 79604169 - 79606296
Public Clones not available
Private Clones OST354542 (lexicon) OST77780 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24720
Vector Insertion
Chr 9: 79603413 - 79604083
Public Clones not available
Private Clones OST209067 (lexicon) OST186312 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034881
Sequence
GGCTTTCGATTTTTGGCGTTCAGTAGTCGCGGTTGGTGGGTAACAACCGAGCCAAGATGTTGCGGAATCTGCTG - UNI19547 - GCCCTTCGTCAG

ATTGCCCAGAGGACCATCAGCACCACTTCACGAAGGCATTTTGAAAACAAGGTTCCAGAGAAACAAAAGCTGTTTCAG - UNI20696 - GAGGATAA

TGGGATGCCAGTTCATCTGAAAGGCGGGGCATCTGATGCCCTCCTCTACAGAGCCACAATGGCTCTGACGCTTGGTG - UNI24720 - GCACAGCCT

ATGCCATCTATCTGTTAGCTATGGCTGCATTTCCCAAGAAGCAGAACTAATGTCGTCATCCCAGTCTTCACGTGGTTCAGTTTCATCAACGCTCGATGGA

CCAGGAATCTGATGAGTAACTGAGCTCTTCTTTGGGGATCAATATTTATTGATGTGTATTAACTGCTGCCAATAAAGCAATCCTTAACC
Translation
MLRNLL - UNI19547 - ALRQIAQRTISTTSRRHFENKVPEKQKLFQ - UNI20696 - EDNGMPVHLKGGASDALLYRATMALTLGG - UNI2

4720 - GTAYAIYLLAMAAFPKKQN

For any suggestions or comments, please send an email to unitrap@crg.es