Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032336 (Nptn)
Chromosomal location
Chr 9: 58430197 - 58500685 (+)
Description
neuroplastin Gene [Source:MGI Symbol;Acc:MGI:108077]
RefSeq_dna
NM_009145 
RefSeq_peptide
NP_033171.2 
UniGene
Mm.408390 
MGI
MGI:108077 
Uniprot/SWISSPROT
P97300 
Human Ortholog
ENSG00000156642 (NPTN)
Omim not available
UniTrap UNI11122
Vector Insertion
Chr 9: 58430196 - 58430334
Public Clones G047C12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30180
Vector Insertion
Chr 9: 58430334 - 58466469
Public Clones 3SE286F06 (ggtc) D089B12 (ggtc) 5SE286F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21663
Vector Insertion
Chr 9: 58466818 - 58471493
Public Clones not available
Private Clones OST322002 (lexicon) OST32369 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10322
Vector Insertion
Chr 9: 58471663 - 58475640
Public Clones LST018 (baygenomics)
Private Clones OST323632 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10245
Vector Insertion
Chr 9: 58475736 - 58477037
Public Clones GST178 (baygenomics) Ex153 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI420
Vector Insertion
Chr 9: 58491610 - 58492267
Public Clones BC0563 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16428
Vector Insertion
Chr 9: 58492278 - 58498303
Public Clones IST14881A1 (tigm)
Private Clones OST461494 (lexicon) OST363902 (lexicon) OST102140 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20333
Vector Insertion
Chr 9: 58499140 - 58499665
Public Clones not available
Private Clones OST367037 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114121
Sequence
ATGTCAGTAGTGGACCTTCCCAACT CTGCTCCTGACATCACTGGCCATAAACGAAGTGAAAACAAAAATGAAGGGCAGGATGCTATGATGTACTGCAAG

TCAGTTGGCTACCCCCACCCAGAGTGGATATGGCGCAAGAAGGAGAATGGTGTGTTTGAG GAGATTTCTAATAGCTCTGGTCGCTTCTTCATCACCAAC

AAGGAGAATTACACTGAATTGAGTATTGTGAATCTCCAAATCACAGAAGATCCTGGAGAGTATGAATGTAATGCCACCAACTCCATTGGCTCTGCCTCCG

TTTCCACCGTCCTCAGGGTACGGAGCCACCTTGCCCCACTTTGGCCTTTCTTGGGAATTCTGGCTGAAATCATCATCCTTGTGGTGATCATTGTTGTGTA

TGAGAAGAGGAAGAGGCCAGATGAGGTTCCTGATG - UNI420 - - UNI16428 - ATGATGAACCAGCTGGGCCAAT GAAAACCAACTCTACCA

ACAATCACAAAGATAAAAACTTGCGCCAGAGAAACACAAATTAAGTACTGCTTTTAAT - UNI20333 - CTCTTTAGGTTCCTGAAAAACGATGGCA

ACATGACCTGCTAAGTTTTCTGCTTGGACCTCTTTGGTCTCTCTCCCTTTCAAGTGAGCAACACCACAATGACCGTCTAAAGCATGCCTTATTTAGCCTC

TCCTATAAGGGTGACCTAGCCAGGTACATTTTAAACAATGCTTCAGTGTAGAAGGTGTAAACTATTTTGGGCTTGATGTGCTGTGAATGTTGCTTTCCCT

CCCTTTGTTAAAAATATTTAAATAGAAATGAAAAGGTCCTCTGAGGATCAGATCATGCATGCGCCATTTTTTACTTATGCAGCTGTTAAATTGGCAAAGC

TCTAAACGCACTGCTGCCATCTAGTGATCATTTTGTAAAGTACAGCAAAACCTACAGATATATACAGTATATAAATATATATATATATTTATATTTTTGG

GGGTGGGAGAAATCCAAAATAAAGTCAACGCTTGTTTCATTTTAAGCTGCTGATACTCATTCCTTATTATTTGTCGTCAGATGAGGAAGCTGCAGTTCTG

GTACAAACTGATGAGAGTGTATAGACTTAAGTCTGGCATTCTAAGGGCTTACCGTATAACTTTAGGAACCTGGAACAGTCCACTGAACGGCTAGAATGAA

TTGCAGTATATATGTATGATTGATTGCTTTTTAAGTGACTATTTTTCCTCTTGTCAAATCATGTAAATTCTGAAATCTTTTGCACTGATGTGTCAAACCT

TATTCTTGTATATTCAATCAAGGCAACTTTTATAATTTCCCATTTGTTTTCAATGACCCTGAAATGTTAATAGCATGGTGATATTCTATGCAACTCTAGT

TACACCTTTTGGTTTGACACTGTATTTTCACATTGATTTCATGACTGATGATAGATTTTATAACCTGACTGGGTTCTCATGCGGTACTAACTGTAGATGC

ATGTACTTGTGTTCTGTGTAATTATTGAAGTGCAATGGTGTACAAAAAAAGTGGATTCACCTGTTTTTAACAATAAAACATTG
Translation
MSVVDLPNS SAPDITGHKRSENKNEGQDAMMYCKSVGYPHPEWIWRKKENGVFE EISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGS

ASVSTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDD - UNI420 - - UNI16428 - DDEPAGPM MKTNSTNNHKDKNLRQRN

TN - UNI20333 - 
Transcript ENSMUST00000074429
Sequence
ATTCGCTGCGCGCTCTCCGGCTAGGGAGGATGTCGGGCTCGTCGCTCCCCGGCGCCCTGGCCCTCTCGCTCTTGCTGGTCTCTGGCTCGCTCCTTCCAGG

GCCAGGCGCTGCTCAGAACG - UNI11122 - - UNI21663 - - UNI30180 - AACCAAGAATTGTCACCAGTGAAGAGGTCATTATTCGAGA

AAGCCTCCTTCCTGTCACCCTGCAGTGTAACCTCACTTCCAGCTCTCACACCCTTATGTACAGCTACTGGACAAGGAATGGGGTAGAACTCACTGCCACC

CGTAAGAATGCCAGCAACATGGAGTACAG - UNI10322 - GATCAATAAGCCAAGAGCTGAGGATTCAGGCGAATACCACTGTGTATATCATTTTGT

CAGCGCTCCTAAAGCAAATGCCACCATTGAAGTGAAAG - UNI10245 - CTGCTCCTGACATCACTGGCCATAAACGAAGTGAAAACAAAAATGAAG

GGCAGGATGCTATGATGTACTGCAAGTCAGTTGGCTACCCCCACCCAGAGTGGATATGGCGCAAGAAGGAGAATGGTGTGTTTGAG GAGATTTCTAATA

GCTCTGGTCGCTTCTTCATCACCAACAAGGAGAATTACACTGAATTGAGTATTGTGAATCTCCAAATCACAGAAGATCCTGGAGAGTATGAATGTAATGC

CACCAACTCCATTGGCTCTGCCTCCGTTTCCACCGTCCTCAGGGTACGGAGCCACCTTGCCCCACTTTGGCCTTTCTTGGGAATTCTGGCTGAAATCATC

ATCCTTGTGGTGATCATTGTTGTGTATGAGAAGAGGAAGAGGCCAGATGAGGTTCCTGATG - UNI420 - CTGGCCCCGA - UNI16428 - GAA

AACCAACTCTACCAACAATCACAAAGATAAAAACTTGCGCCAGAGAAACACAAATTAA
Translation
MSGSSLPGALALSLLLVSGSLLPGPGAAQNE - UNI11122 - - UNI21663 - - UNI30180 - EPRIVTSEEVIIRESLLPVTLQCNLTSSS

HTLMYSYWTRNGVELTATRKNASNMEYR - UNI10322 - RINKPRAEDSGEYHCVYHFVSAPKANATIEVKA - UNI10245 - AAPDITGHKRS

ENKNEGQDAMMYCKSVGYPHPEWIWRKKENGVFE EISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWPFLG

ILAEIIILVVIIVVYEKRKRPDEVPDA - UNI420 - AGPE - UNI16428 - EKTNSTNNHKDKNLRQRNTN
Transcript ENSMUST00000034887
Sequence
ATTCGCTGCGCGCTCTCCGGCTAGGGAGGATGTCGGGCTCGTCGCTCCCCGGCGCCCTGGCCCTCTCGCTCTTGCTGGTCTCTGGCTCGCTCCTTCCAGG

GCCAGGCGCTGCTCAGAACG - UNI11122 - - UNI21663 - - UNI30180 - AACCAAGAATTGTCACCAGTGAAGAGGTCATTATTCGAGA

AAGCCTCCTTCCTGTCACCCTGCAGTGTAACCTCACTTCCAGCTCTCACACCCTTATGTACAGCTACTGGACAAGGAATGGGGTAGAACTCACTGCCACC

CGTAAGAATGCCAGCAACATGGAGTACAG - UNI10322 - GATCAATAAGCCAAGAGCTGAGGATTCAGGCGAATACCACTGTGTATATCATTTTGT

CAGCGCTCCTAAAGCAAATGCCACCATTGAAGTGAAAG - UNI10245 - CTGCTCCTGACATCACTGGCCATAAACGAAGTGAAAACAAAAATGAAG

GGCAGGATGCTATGATGTACTGCAAGTCAGTTGGCTACCCCCACCCAGAGTGGATATGGCGCAAGAAGGAGAATGGTGTGTTTGAG GAGATTTCTAATA

GCTCTGGTCGCTTCTTCATCACCAACAAGGAGAATTACACTGAATTGAGTATTGTGAATCTCCAAATCACAGAAGATCCTGGAGAGTATGAATGTAATGC

CACCAACTCCATTGGCTCTGCCTCCGTTTCCACCGTCCTCAGGGTACGGAGCCACCTTGCCCCACTTTGGCCTTTCTTGGGAATTCTGGCTGAAATCATC

ATCCTTGTGGTGATCATTGTTGTGTATGAGAAGAGGAAGAGGCCAGATGAGGTTCCTGATG - UNI420 - - UNI16428 - ATGATGAACCAGCT

GGGCCAAT GAAAACCAACTCTACCAACAATCACAAAGATAAAAACTTGCGCCAGAGAAACACAAATTAA
Translation
MSGSSLPGALALSLLLVSGSLLPGPGAAQNE - UNI11122 - - UNI21663 - - UNI30180 - EPRIVTSEEVIIRESLLPVTLQCNLTSSS

HTLMYSYWTRNGVELTATRKNASNMEYR - UNI10322 - RINKPRAEDSGEYHCVYHFVSAPKANATIEVKA - UNI10245 - AAPDITGHKRS

ENKNEGQDAMMYCKSVGYPHPEWIWRKKENGVFE EISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWPFLG

ILAEIIILVVIIVVYEKRKRPDEVPDD - UNI420 - - UNI16428 - DDEPAGPM MKTNSTNNHKDKNLRQRNTN
Transcript ENSMUST00000085651
Sequence
GGCCCCGGCCCCGGCCCATTCGCTGCGCGCTCTCCGGCTAGGGAGGATGTCGGGCTCGTCGCTCCCCGGCGCCCTGGCCCTCTCGCTCTTGCTGGTCTCT

GGCTCGCTCCTTCCAGGGCCAGGCGCTGCTCAGAACG - UNI11122 - - UNI30180 - CTGGGTTTGTCAAGTCGCCCATGTCAGAAACTAAGC

TCACGGGGGACGCCTTTGAGCTGTACTGTGACGTGGTCGGGAGTCCCACGCCAGAGATCCAGTGGTGGTACGCAGAAGTCAACCGGGCAGAGTCTTTCAG

ACAGCTGTGGGACGGTGCTCGGAAGCGCCGTGTCACCGTAAACACCGCCTACGGGTCAAACGGCGTGAGTGTGCTGAGAATAACCCGGCTCACCTTGGAG

GACTCTGGGACTTACGAGTGCAGGGCCAGCAACGACCCCAAGAGGAATGACTTGAGGCAAAACCCTTCCATAACATGGATTCGAGCCCAGGCCACCATAA

GCGTCCTTCAGA - UNI21663 - AACCAAGAATTGTCACCAGTGAAGAGGTCATTATTCGAGAAAGCCTCCTTCCTGTCACCCTGCAGTGTAACCTC

ACTTCCAGCTCTCACACCCTTATGTACAGCTACTGGACAAGGAATGGGGTAGAACTCACTGCCACCCGTAAGAATGCCAGCAACATGGAGTACAG - UN

I10322 - GATCAATAAGCCAAGAGCTGAGGATTCAGGCGAATACCACTGTGTATATCATTTTGTCAGCGCTCCTAAAGCAAATGCCACCATTGAAGTG

AAAG - UNI10245 - CTGCTCCTGACATCACTGGCCATAAACGAAGTGAAAACAAAAATGAAGGGCAGGATGCTATGATGTACTGCAAGTCAGTTGG

CTACCCCCACCCAGAGTGGATATGGCGCAAGAAGGAGAATGGTGTGTTTGAG GAGATTTCTAATAGCTCTGGTCGCTTCTTCATCACCAACAAGGAGAA

TTACACTGAATTGAGTATTGTGAATCTCCAAATCACAGAAGATCCTGGAGAGTATGAATGTAATGCCACCAACTCCATTGGCTCTGCCTCCGTTTCCACC

GTCCTCAGGGTACGGAGCCACCTTGCCCCACTTTGGCCTTTCTTGGGAATTCTGGCTGAAATCATCATCCTTGTGGTGATCATTGTTGTGTATGAGAAGA

GGAAGAGGCCAGATGAGGTTCCTGATG - UNI420 - - UNI16428 - ATGATGAACCAGCTGGGCCAAT GAAAACCAACTCTACCAACAATCAC

AAAGATAAAAACTTGCGCCAGAGAAACACAAATTAAGTACTGCTTTTAAT - UNI20333 - CTCTTTAGGTTCCTGAAAAACGATGGCAACATGACC

TGCTAAGTTTTCTGCTTGGACCTCTTTGGTCTCTCTCCCTTTCAAGTGAGCAACACCACAATGACCGTCTAAAGCATGCCTTATTTAGCCTCTCCTATAA

GGGTGACCTAGCCAGGTACATTTTAAACAATGCTTCAGTGTAGAAGGTGTAAACTATTTTGGGCTTGATGTGCTGTGAATGTTGCTTTCCCTCCCTTTGT

TAAAAATATTTAAATAGAAATGAAAAGGTCCTCTGAGGATCAGATCATGCATGCGCCATTTTTTACTTATGCAGCTGTTAAATTGGCAAAGCTCTAAACG

CACTGCTGCCATCTAGTGATCATTTTGTAAAGTACAGCAAAACCTACAGATATATACAGTATATAAATATATATATATATTTATATTTTTGGGGGTGGGA

GAAATCCAAAATAAAGTCAACGCTTGTTTCATTTTAAGCTGCTGATACTCATTCCTTATTATTTGTCGTCAGATGAGGAAGCTGCAGTTCTGGTACAAAC

TGATGAGAGTGTATAGACTTAAGTCTGGCATTCTAAGGGCTTACCGTATAACTTTAGGAACCTGGAACAGTCCACTGAACGGCTAGAATGAATTGCAGTA

TATATGTATGATTGATTGCTTTTTAAGTGACTATTTTTCCTCTTGTCAAATCATGTAAATTCTGAAATCTTTTGCACTGATGTGTCAAACCTTATTCTTG

TATATTCAATCAAGGCAACTTTTATAATTTCCCATTTGTTTTCAATGACCCTGAAATGTTAATAGCATGGTGATATTCTATGCAACTCTAGTTACACCTT

TTGGTTTGACACTGTATTTTCACATTGATTTCATGACTGATGATAGATTTTATAACCTGACTGGGTTCTCATGCGGTACTAACTGTAGATGCATGTACTT

GTGTTCTGTGTAATTATTGAAGTGCAATGGTGTACAAAAAAAGTGGATTCACCTGTTTTTAACAATAAAACATTGATAAAAGGT
Translation
MSGSSLPGALALSLLLVSGSLLPGPGAAQNA - UNI11122 - - UNI30180 - AGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVNRA

ESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLRQNPSITWIRAQATISVLQK - UNI21663 - KPRIVTSEEVI

IRESLLPVTLQCNLTSSSHTLMYSYWTRNGVELTATRKNASNMEYR - UNI10322 - RINKPRAEDSGEYHCVYHFVSAPKANATIEVKA - UNI1

0245 - AAPDITGHKRSENKNEGQDAMMYCKSVGYPHPEWIWRKKENGVFE EISNSSGRFFITNKENYTELSIVNLQITEDPGEYECNATNSIGSASV

STVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDD - UNI420 - - UNI16428 - DDEPAGPM MKTNSTNNHKDKNLRQRNTN 

- UNI20333 - 

For any suggestions or comments, please send an email to unitrap@crg.es