Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032349 (Elovl5)
Chromosomal location
Chr 9: 77765172 - 77832323 (+)
Description
ELOVL family member 5, elongation of long chain fatty acids (yeast) Gene [Source:MGI (curated);Acc:Elovl5-001]
RefSeq_dna
NM_134255 
RefSeq_peptide
NP_599016.2 
UniGene
Mm.430736 Mm.475262 
MGI
MGI:1916051 
Uniprot/SWISSPROT
Q8BHI7 
Human Ortholog
ENSG00000012660 (ELOVL5)
Omim not available
UniTrap UNI10643
Vector Insertion
Chr 9: 77765334 - 77804947
Public Clones M119G04 (ggtc) D180A03 (ggtc) P026B12 (ggtc) D005H01 (ggtc) (ggtc)
F011D05 (ggtc) P023F05 (ggtc) D007E10 (ggtc) Q009B08 (ggtc) W215D04 (ggtc)
P138G11 (ggtc) P026H07 (ggtc) P009G03 (ggtc) IST14265G11 (tigm) IST14939G9 (tigm)
IST14591E9 (tigm) IST15027F7 (tigm) IST14683B4 (tigm) IST11636G9 (tigm)
Private Clones OST456066 (lexicon) OST441761 (lexicon) OST416630 (lexicon) OST408469 (lexicon)
OST388181 (lexicon) OST360058 (lexicon) OST339167 (lexicon) OST319903 (lexicon)
OST314898 (lexicon) OST296110 (lexicon) OST292768 (lexicon) OST275226 (lexicon)
OST269749 (lexicon) OST269724 (lexicon) OST251005 (lexicon) OST232866 (lexicon)
OST206868 (lexicon) OST195255 (lexicon) OST194638 (lexicon) OST192453 (lexicon)
OST190062 (lexicon) OST184757 (lexicon) OST179692 (lexicon) OST179105 (lexicon)
OST174239 (lexicon) OST173217 (lexicon) OST164822 (lexicon) OST151943 (lexicon)
OST150982 (lexicon) OST118917 (lexicon) OST98928 (lexicon) OST84897 (lexicon)
OST65296 (lexicon) OST37028 (lexicon) OST33484 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18252
Vector Insertion
Chr 9: 77805014 - 77808672
Public Clones not available
Private Clones OST426934 (lexicon) OST390196 (lexicon) OST379987 (lexicon) OST321512 (lexicon)
OST303674 (lexicon) OST279568 (lexicon) OST239985 (lexicon) OST235557 (lexicon)
OST224498 (lexicon) OST205015 (lexicon) OST197174 (lexicon) OST166650 (lexicon)
OST149865 (lexicon) OST109449 (lexicon) OST106697 (lexicon) OST60930 (lexicon)
OST60928 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1506
Vector Insertion
Chr 9: 77808861 - 77823591
Public Clones CC0725 (sanger) G068D07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22189
Vector Insertion
Chr 9: 77823670 - 77824554
Public Clones not available
Private Clones OST303828 (lexicon) OST281188 (lexicon) OST275792 (lexicon) OST123416 (lexicon)
OST123411 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24011
Vector Insertion
Chr 9: 77829416 - 77830471
Public Clones not available
Private Clones OST237623 (lexicon) OST224992 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034904
Sequence
TTGTGACGTCACGGTCAGCCCACGCCGGGGTTGAAGCTGCCGGGCGCCTTCCTCTTGCATCGCGGCTGCAGCTTGCTTCTGTTCCCGCGCCCGCTTGCAC

ATCCTCCTGCTCGCGCGGTCCTGCTGCCGTCCGGTGCTCCCCGTAGCCGCTCAGGCAGAGAG - UNI10643 - GTTTTAAAATGGAACATTTCGATG

CGTCACTCAGTACCTATTTCAAGGCCTTCCTGGGCCCCCGAG - UNI18252 - ATACAAGAGTCAAAGGATGGTTCCTCCTGGACAATTACATCCCT

ACGTTTGTCTGTTCTGTTATTTACTTACTCATTGTATGGCTGGGACCAAAATACATGAAGAACCGGCAGCCGTTCTCTTGCCGAGGCATCCTGCAGTTGT

ATAACCTTGGACTCACCCTGCTGTCTCTCTACATGTTCTATGAG - UNI1506 - TTGGTGACAGGTGTGTGGGAAGGCAAATACAACTTTTTCTGCC

AGGGAACACGCAGCGCGGGAGAATCCGATATGAAG - UNI22189 - ATCATCCGCGTCCTCTGGTGGTACTACTTCTCCAAACTCATCGAATTCATG

GACACCTTTTTCTTCATCCTTCGCAAGAACAACCACCAGATCACCGTGCTCCATGTCTACCACCACGCTACCATGCTCAACATCTGGTGGTTTGTGATGA

ACTGGGTTCCCTGCGGCCATT CATATTTTGGTGCGACACTCAACAGCTTCATCCATGTCCTCATGTACTCGTACTATGGTCTGTCCTCCATCCCGTCCA

TGCGTCCCTACCTCTGGTGGAAAAAGTACATCACTCAAGGGCAGCTG GTCCAGTTTGTGCTGACAATCATCCAGACGACCTGCGGGGTCTTCTGGCCAT

GCTCCTTCCCTCTCGGGTGGCTGTTCTTCCAGATTGGATACATGATTTCCCTGATTGCTCTCTTCACAAACTTCTACATTCAG - UNI24011 - ACT

TACAACAAGAAAGGGGCCTCTCGGAGGAAAGACCACCTGAAGGGCCACCAGAACGGGTCTGTGGCCGCCGTCAACGGACACACCAACAGCTTCCCTTCCC

TGGAAAACAGCGTGAAGCCCAGGAAGCAGCGAAAGGATTGACAAGCCGAGCCGAAGCCTCCAGACCGCGGCGTGTGATTGTAAGCACAGCGTGACTTGTG

CCCTGACGCTCATAGCAGCTGCTGTCACTAGTCTGGCCCTACTATCTGCAGTGTGACTCATGTAGGACCTTCTTCATCAGTTCAAAACCCCTAGAATATG

TATACAGATTATACAAAGTAGGCATACGATTTTCTCACATTTCTGGGCTCTCATCGACCCCCGCGCTAGACTGTGGAAAGGGAATGTTCTTGTAGTATAC

AACACTGCTGTTGCCTTATTAGTTGTAACACGATAGGTGCTGAATTGTGGTTCACAATTTAAAACACTGTAATCCAAACTTTTTTTTTTTAACTGTAGAC

CATGCATGTGATTGTAAATTTGTACAATGTTGTTAACAGTAGAAAAACACACATGCCTTAAGACTTAAAAAAGCAGGGCCCAGAGCTTGTTAGTTTAATT

AGGGTATGTTTCAACTTTGTATTATTCATTTGTATTAGCTCTGTTTAGAAAAATCAAATGTATGATTTATGAAACAAGTGTGTGATGTGTAACTTCAAGT

GACTTGGAGATGCGAAATCTGATGGCACCCTTGGTTTTATAACGATGGCTTTAAATAAGCAGGTTCAAGTCTAGTGGAACAGTCAGTTTAACTTTTTAAC

AGATCTTATTTTTTTATTTTGAGTGCCACTATTAATGTGTTTAAAGAGGTGGGGAAAGGGTCCAAAGCGTCTGGAGACACTTACGTACCTGTCCCTGGTC

CCCCAGAGGCTAGGGTGACTATAAGAGTAGGTCACTTTTCACTTCTGAAGTGCTTAGTGTTTTTATACAGGAGATAAAAAGGCCATTCGACTTCCCACCA

CTTGGAGAGAGAGAACTACCTTTCAGGAAAGGTGACGAGACATTTATTATCTGACAGACACACACACACACACACACAGTGATAAGGGACTGGTTACCTG

GGTCCACATTTTTTTTTATTCTTTTCTGTAGTGCTACTTTGACATACACTTCCTTTTAAAATGTGCCTAATTTACCAAGAGACCAGGAAGCACCATAAGC

ATTTTGAGGTAAAATTTAAGAGCTGGAGCGCGCAGGAACTGGGTGTTTGGGAGCAACCGCTTTTTTCAGTGTGAATCATGGTGGCATCTGTAATTTTTTT

CTGATTAGCACCTAAAGATCGGTTTAAAGTGCTTGGACTGCTTATCCTAAAATCGTGTCTAGTGCGCTCGAGGCATCGGTCATACAAATGGGGACTCTTT

TCATGTGTGTCATTTTTAAAGTGTTGAAAGCTTAGCCTTTGAATACCTTCTGCATTGGTAAAAAATCCATGGAACCACTCATGGCACATCTTAGGAGATG

ATTGACAATGTATAAACTAATTGTGGGTTTGATATTTATGTAAATACCAGTTTACCATGCTTTAATTTTGCACATTCATATTACAAGGAGCCAGTTGGTC

CTAATTAGCCTTGTGGGTTTTCTGTTTGGAAGGAGTTGCGGCATCTGTTTACATTTCCCTTGTCAGATCTAGAATGTGTGTATGTGTGTGTCTTCTCCCT

AGGTACCCGTCTGCAGGTGTCTTTACATATCTCAATACAAAAATTATAACATTTGATAGTGTGCTGTCAAAGTGTGCTTAGCTCATCTGGATATACCCAC

ACTGTTAAATAATGTCTAAACATTAATCATTAAAACCTTTTTGATTACC
Translation
 - UNI10643 - MEHFDASLSTYFKAFLGPRD - UNI18252 - DTRVKGWFLLDNYIPTFVCSVIYLLIVWLGPKYMKNRQPFSCRGILQLYNLG

LTLLSLYMFYE - UNI1506 - LVTGVWEGKYNFFCQGTRSAGESDMK - UNI22189 - IIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHV

YHHATMLNIWWFVMNWVPCGHS SYFGATLNSFIHVLMYSYYGLSSIPSMRPYLWWKKYITQGQL VQFVLTIIQTTCGVFWPCSFPLGWLFFQIGYMIS

LIALFTNFYIQ - UNI24011 - TYNKKGASRRKDHLKGHQNGSVAAVNGHTNSFPSLENSVKPRKQRKD

For any suggestions or comments, please send an email to unitrap@crg.es