Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032352 (Lrrc1)
Chromosomal location
Chr 9: 77278630 - 77392677 (-)
Description
leucine rich repeat containing 1 Gene [Source:MGI Symbol;Acc:MGI:2442313]
RefSeq_peptide
NP_766116.2 
UniGene
Mm.28534 
MGI
MGI:2442313 
Uniprot/SWISSPROT
Q80VQ1 
Uniprot/SPTREMBL
Q8QZU1 Q571M3 
Human Ortholog
ENSG00000137269 (LRRC1)
Omim not available
UniTrap UNI2203
Vector Insertion
Chr 9: 77300529 - 77302964
Public Clones XR0433 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2549
Vector Insertion
Chr 9: 77297395 - 77299164
Public Clones XS0438 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113419
Sequence
CGGCGGAGGGGGCGGTGGGAGGGGACGCTCGCGACTGTGGCGAAGGCGCGGGACGCGGCGAGGGTTCCCGCGGCTTCCTCAGAACGTTCGGGACGGTGGA

GTCCTTGCGAGGCGCGAGCGAGCTTGGAGCCAGCAACGAGCTTGGAGCGGGCGGCGGGCGGGGAGCAGCGGGGCGGCCGGGCGGAGCGGGCTCCGAGCCC

CGGGCTCCGCGGCTCGGCGGGACACGGCTCTGGTGGTGGAGGCGGCGATGTTCCACTGCATTCCCCTGTGGCGGTGCAACCGTCATGTGGAGGCCATCGA

CAAGCGCCACTGCTCGCTGGTCTACGTCCCCGAGGAGATCTACCGCTATGCCCGCAGCCTGGAGGAGCTGCTGCTGGACGCCAACCAGCTCCGGGAGCTC

CCCGAG CAATTTTTCCAGCTAGTCAAATTACGGAAGCTTGGGCTCAGTGATAATGAAATTCAGCGGCTCCCTCCAGAAATAGCAAACTTCATGCAGCTC

GTGGAACTTGACGTGTCCCGGAATG ATATACCTGAAATTCCAGAAAGCATCGCCTTCTGTAAAGCGCTGCAGGTAGCTGACTTCAGCGGAAACCCACTC

ACCAG GTTGCCTGAGAGCTTTCCTGAACTACAGAACTTAACGTGTCTTTCTGTAAATGACATCTCGCTGCAGTCTCTGCCAGAGAATATTGGAAA TCT

CTATAACCTGGCTTCACTGGAACTGAGAGAGAATCTTCTTACATATCTTCCTGA CTCTCTTACCCAACTAAGGAGACTAGAAGAACTTGATTTAGGAAA

CAATGAAATCTACAATTTG CCAGAATCAATTGGGGCACTCCTACATCTGAAGGATCTCTGGTTGGATGGAAATCAGCTGTCTGAATTACCTCAG GAAA

TCGGCAATCTGAAGAACCTCCTCTGCCTAGATGTCTCTGAAAACAGGCTGGAGAGACTTCCTGAAGAGATCAGCGGCCTGACTTCTTTGACATACTTAGT

CATTTCCCAGAACTTGCTAGAAACAATTCCTGAGGGCATTG - UNI2203 - GAAAACTAAAGAAGCTGTCAATCTTGAAGTTGGATCAGAACAGACT

CACACAGTTGCCCGAAGCAATTGGGGATTGTGAAAATCTCACGGAGTTAGTTCTTACAGAAAACCGGCTCCTG ACTTTACCTAAGAGCATTGGAAAACT

TAAGAAGTTGAGCAACTTGAATGCAGACAGGAATAAATTAGTGTCATTGCCAAAAGAG - UNI2549 - GAACACATTTCAGGCAAGGTCTGTAGATT

GTTTTATCACAAAGCTGCCACTGCCATTTGA
Translation
MFHCIPLWRCNRHVEAIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPE QFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRND DIPEI

PESIAFCKALQVADFSGNPLTR RLPESFPELQNLTCLSVNDISLQSLPENIGN NLYNLASLELRENLLTYLPD DSLTQLRRLEELDLGNNEIYNL P

ESIGALLHLKDLWLDGNQLSELPQ EIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIG - UNI2203 - GKLKKLSILKLDQ

NRLTQLPEAIGDCENLTELVLTENRLL TLPKSIGKLKKLSNLNADRNKLVSLPKE - UNI2549 - EHISGKVCRLFYHKAATAI
Transcript ENSMUST00000113421
Sequence
AGGTCCCAGAGGATGTGGGGACCCAGCAGCGCGAAA CAATTTTTCCAGCTAGTCAAATTACGGAAGCTTGGGCTCAGTGATAATGAAATTCAGCGGCTC

CCTCCAGAAATAGCAAACTTCATGCAGCTCGTGGAACTTGACGTGTCCCGGAATG ATATACCTGAAATTCCAGAAAGCATCGCCTTCTGTAAAGCGCTG

CAGGTAGCTGACTTCAGCGGAAACCCACTCACCAG GTTGCCTGAGAGCTTTCCTGAACTACAGAACTTAACGTGTCTTTCTGTAAATGACATCTCGCTG

CAGTCTCTGCCAGAGAATATTGGAAA TCTCTATAACCTGGCTTCACTGGAACTGAGAGAGAATCTTCTTACATATCTTCCTGA CTCTCTTACCCAACT

AAGGAGACTAGAAGAACTTGATTTAGGAAACAATGAAATCTACAATTTG CCAGAATCAATTGGGGCACTCCTACATCTGAAGGATCTCTGGTTGGATGG

AAATCAGCTGTCTGAATTACCTCAG GAAATCGGCAATCTGAAGAACCTCCTCTGCCTAGATGTCTCTGAAAACAGGCTGGAGAGACTTCCTGAAGAGAT

CAGCGGCCTGACTTCTTTGACATACTTAGTCATTTCCCAGAACTTGCTAGAAACAATTCCTGAGGGCATTG - UNI2203 - GAAAACTAAAGAAGCT

GTCAATCTTGAAGTTGGATCAGAACAGACTCACACAGTTGCCCGAAGCAATTGGGGATTGTGAAAATCTCACGGAGTTAGTTCTTACAGAAAACCGGCTC

CTG ACTTTACCTAAGAGCATTGGAAAACTTAAGAAGTTGAGCAACTTGAATGCAGACAGGAATAAATTAGTGTCATTGCCAAAAGAG - UNI2549 -

 ATTGGCGGGTGCTGCAGCCTCACCATGTTCTGCATCCGGGACAACAGACTGACTCGGTTACCTGCAGAGGTGTCACAGGCCGTGGAACTTCATGTCCTC

GACGTGGCAGGGAACAG GTTACATCATCTGCCCTTATCGCTGACCACCCTGAAGTTGAAGGCCCTGTGGTTATCTGACAACCAGTCGCAGCCTCTCCTC

ACGTTCCAGACAGACATAGACCGAGCCACCGGGGAGAAGATTTTAACGTGTGTCTTACTTCCTCAGATGCCTTCTGAACCCATCTGCCAAG AGAGCCTG

CCGCGTTGCGGTGCCCTGGAGAGTCTGGTAACTGACATGTCTGAGGAAGCCTGGAATGACCGCTCGGTCCACAGAGTTAGTGCAATCCGGTTTTTGGAAG

ACGAGAAGGACGAAGATGAAAACGAAACG AGAACACTTCAGAGGCGAGCCACTCCACACCCAGGGGAATTAAAGAACATGAAAAAGACGGTGGAGAATT

TACGGAACGACATGAATGCCGCCAAAGGACTGGATTCAAACAAAAACGAGGTCAACCACGCCGCTGAGCGCGTGACCACATCGGTGTAGCATTGACCTCC

GAGTTTTACCTGCTGTGTCTTCCCTGCTGTAGAGATGTTCCTGTGCACCTGAGGAGCCTCCTGCCTGCCGTCCTTGCGTCCACCATCCCTCTGCCAGGAT

GCTGCTCTTGCACCAAGTGCCTTCTGCATCCCTCAGTCCATCCGCGTACCAGTAGCCTCCCGTCCTAATTCTGTTCAATATCAGTTGTTCCTAATAAGTA

GAATACACTACTGTCAACACCTGACCTTCGTTTTTGTCTTGTGTTGGGGTTAGAGAGAGCAGGAAGGGGGTTCTGACCCTCTTCCCTCCACTGAGTGCTG

GACATTCGGAACCCAAGTTCTTATGGACCTACGGAGGAGAGAGAGAAAGCTTTATGTATGGGGGAAAAAAAGATACTTTTTTATCCTTTCTTGGCAGCTC

AGATGGTGTAAATTTTAAAATTTTGTATAGGTATTTCATAACAAAAAATTATGTATTTCTTTGTTATTTTATCTTGAAGACGGTACATATTTTCGTATTT

GTGCAGAAAAACAAATTAGGCCTAAAGTATTGGTTTTTACCTGTACCATCCACTCCGTGCCTTACTGTATCCTGTCCTGTCACAGCGGCTGCAAACAGTG

GCATCCTTGAGCAGCAAGATGGGCGCCTGGGTGTGGTCTTGTTAAATCGGTGTCGCACATTTTAATCGGTAATCTGCTGGCTTGTTTGTTAACCAGAACG

ATGAATTTATCAGTGATTTGTAAGTTTCATCAAGTGATTTCTTCGACAAGATGAACCAAAGGATTAGCCTCGCGCTACGTCATTGCATCCGCTCCCCCTC

GTCCTGACTCAGCTCGGGTGTGTGCAGCATCAGGCTGTGCCTGCTCCAGAGGCATGGGCCACCTGGGTAACAGCACACAGCAGAAAAGCACAGAGAGAAA

AACAACTGGTCCAGAAATTCAGTGGATCCATGACTTACGTGTCACAGAAGAATGACTGTTGCCGAAGGAAGCTTAAAAATTCTATATCCAGATAAAAGAC

CACAATAAAGCAAAAGTCACCT
Translation
MWGPSSAK QFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRND DIPEIPESIAFCKALQVADFSGNPLTR RLPESFPELQNLTCLSVNDISL

QSLPENIGN NLYNLASLELRENLLTYLPD DSLTQLRRLEELDLGNNEIYNL PESIGALLHLKDLWLDGNQLSELPQ EIGNLKNLLCLDVSENRLER

LPEEISGLTSLTYLVISQNLLETIPEGIG - UNI2203 - GKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLL TLPKSIGKLKKLSNLNA

DRNKLVSLPKE - UNI2549 - IGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNR RLHHLPLSLTTLKLKALWLSDNQSQPLLTFQTDIDR

ATGEKILTCVLLPQMPSEPICQE ESLPRCGALESLVTDMSEEAWNDRSVHRVSAIRFLEDEKDEDENET RTLQRRATPHPGELKNMKKTVENLRNDMN

AAKGLDSNKNEVNHAAERVTTSV
Transcript ENSMUST00000049755
Sequence
CGGCGGAGGGGGCGGTGGGAGGGGACGCTCGCGACTGTGGCGAAGGCGCGGGACGCGGCGAGGGTTCCCGCGGCTTCCTCAGAACGTTCGGGACGGTGGA

GTCCTTGCGAGGCGCGAGCGAGCTTGGAGCCAGCAACGAGCTTGGAGCGGGCGGCGGGCGGGGAGCAGCGGGGCGGCCGGGCGGAGCGGGCTCCGAGCCC

CGGGCTCCGCGGCTCGGCGGGACACGGCTCTGGTGGTGGAGGCGGCGATGTTCCACTGCATTCCCCTGTGGCGGTGCAACCGTCATGTGGAGGCCATCGA

CAAGCGCCACTGCTCGCTGGTCTACGTCCCCGAGGAGATCTACCGCTATGCCCGCAGCCTGGAGGAGCTGCTGCTGGACGCCAACCAGCTCCGGGAGCTC

CCCGAG CAATTTTTCCAGCTAGTCAAATTACGGAAGCTTGGGCTCAGTGATAATGAAATTCAGCGGCTCCCTCCAGAAATAGCAAACTTCATGCAGCTC

GTGGAACTTGACGTGTCCCGGAATG ATATACCTGAAATTCCAGAAAGCATCGCCTTCTGTAAAGCGCTGCAGGTAGCTGACTTCAGCGGAAACCCACTC

ACCAG GTTGCCTGAGAGCTTTCCTGAACTACAGAACTTAACGTGTCTTTCTGTAAATGACATCTCGCTGCAGTCTCTGCCAGAGAATATTGGAAA TCT

CTATAACCTGGCTTCACTGGAACTGAGAGAGAATCTTCTTACATATCTTCCTGA CTCTCTTACCCAACTAAGGAGACTAGAAGAACTTGATTTAGGAAA

CAATGAAATCTACAATTTG CCAGAATCAATTGGGGCACTCCTACATCTGAAGGATCTCTGGTTGGATGGAAATCAGCTGTCTGAATTACCTCAG GAAA

TCGGCAATCTGAAGAACCTCCTCTGCCTAGATGTCTCTGAAAACAGGCTGGAGAGACTTCCTGAAGAGATCAGCGGCCTGACTTCTTTGACATACTTAGT

CATTTCCCAGAACTTGCTAGAAACAATTCCTGAGGGCATTG - UNI2203 - GAAAACTAAAGAAGCTGTCAATCTTGAAGTTGGATCAGAACAGACT

CACACAGTTGCCCGAAGCAATTGGGGATTGTGAAAATCTCACGGAGTTAGTTCTTACAGAAAACCGGCTCCTG ACTTTACCTAAGAGCATTGGAAAACT

TAAGAAGTTGAGCAACTTGAATGCAGACAGGAATAAATTAGTGTCATTGCCAAAAGAG - UNI2549 - ATTGGCGGGTGCTGCAGCCTCACCATGTT

CTGCATCCGGGACAACAGACTGACTCGGTTACCTGCAGAGGTGTCACAGGCCGTGGAACTTCATGTCCTCGACGTGGCAGGGAACAG GTTACATCATCT

GCCCTTATCGCTGACCACCCTGAAGTTGAAGGCCCTGTGGTTATCTGACAACCAGTCGCAGCCTCTCCTCACGTTCCAGACAGACATAGACCGAGCCACC

GGGGAGAAGATTTTAACGTGTGTCTTACTTCCTCAGATGCCTTCTGAACCCATCTGCCAAG AGAGCCTGCCGCGTTGCGGTGCCCTGGAGAGTCTGGTA

ACTGACATGTCTGAGGAAGCCTGGAATGACCGCTCGGTCCACAGAGTTAGTGCAATCCGGTTTTTGGAAGACGAGAAGGACGAAGATGAAAACGAAACG 

AGAACACTTCAGAGGCGAGCCACTCCACACCCAGGGGAATTAAAGAACATGAAAAAGACGGTGGAGAATTTACGGAACGACATGAATGCCGCCAAAGGAC

TGGATTCAAACAAAAACGAGGTCAACCACGCCGCTGAGCGCGTGACCACATCGGTGTAGCATTGACCTCCGAGTTTTACCTGCTGTGTCTTCCCTGCTGT

AGAGATGTTCCTGTGCACCTGAGGAGCCTCCTGCCTGCCGTCCTTGCGTCCACCATCCCTCTGCCAGGATGCTGCTCTTGCACCAAGTGCCTTCTGCATC

CCTCAGTCCATCCGCGTACCAGTAGCCTCCCGTCCTAATTCTGTTCAATATCAGTTGTTCCTAATAAGTAGAATACACTACTGTCAACACCTGACCTTCG

TTTTTGTCTTGTGTTGGGGTTAGAGAGAGCAGGAAGGGGGTTCTGACCCTCTTCCCTCCACTGAGTGCTGGACATTCGGAACCCAAGTTCTTATGGACCT

ACGGAGGAGAGAGAGAAAGCTTTATGTATGGGGGAAAAAAAGATACTTTTTTATCCTTTCTTGGCAGCTCAGATGGTGTAAATTTTAAAATTTTGTATAG

GTATTTCATAACAAAAAATTATGTATTTCTTTGTTATTTTATCTTGAAGACGGTACATATTTTCGTATTTGTGCAGAAAAACAAATTAGGCCTAAAGTAT

TGGTTTTTACCTGTACCATCCACTCCGTGCCTTACTGTATCCTGTCCTGTCACAGCGGCTGCAAACAGTGGCATCCTTGAGCAGCAAGATGGGCGCCTGG

GTGTGGTCTTGTTAAATCGGTGTCGCACATTTTAATCGGTAATCTGCTGGCTTGTTTGTTAACCAGAACGATGAATTTATCAGTGATTTGTAAGTTTCAT

CAAGTGATTTCTTCGACAAGATGAACCAAAGGATTAGCCTCGCGCTACGTCATTGCATCCGCTCCCCCTCGTCCTGACTCAGCTCGGGTGTGTGCAGCAT

CAGGCTGTGCCTGCTCCAGAGGCATGGGCCACCTGGGTAACAGCACACAGCAGAAAAGCACAGAGAGAAAAACAACTGGTCCAGAAATTCAGTGGATCCA

TGACTTACGTGTCACAGAAGAATGACTGTTGCCGAAGGAAGCTTAAAAATTCTATATCCAGATAAAAGACCACAATAAAGCAAAAGTCACCTATACCGTA

ATAGAAATGTTGCTATCTCTATACAAGTGCACTTTGATCTGTAAATAGTTCTAATCAAAGCATAACAAAACACTGCTTCAAGATTTACTTTTAAATCTAA

TTTAAGGGGTGTTTTTACTGTGTTTTTGTCGTTTCCTTTTTACGTGTGCTGTGATGAAAGAGAAAAATGCAGAGTGCCAGTCACTGTGGTGTCTGGGGGA

AATCACCGGGGTTCAGGGGAGGGGATTTCCCCGTGAAATAAACTCATCATGGACACTG
Translation
MFHCIPLWRCNRHVEAIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPE QFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRND DIPEI

PESIAFCKALQVADFSGNPLTR RLPESFPELQNLTCLSVNDISLQSLPENIGN NLYNLASLELRENLLTYLPD DSLTQLRRLEELDLGNNEIYNL P

ESIGALLHLKDLWLDGNQLSELPQ EIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIG - UNI2203 - GKLKKLSILKLDQ

NRLTQLPEAIGDCENLTELVLTENRLL TLPKSIGKLKKLSNLNADRNKLVSLPKE - UNI2549 - IGGCCSLTMFCIRDNRLTRLPAEVSQAVELH

VLDVAGNR RLHHLPLSLTTLKLKALWLSDNQSQPLLTFQTDIDRATGEKILTCVLLPQMPSEPICQE ESLPRCGALESLVTDMSEEAWNDRSVHRVSA

IRFLEDEKDEDENET RTLQRRATPHPGELKNMKKTVENLRNDMNAAKGLDSNKNEVNHAAERVTTSV

For any suggestions or comments, please send an email to unitrap@crg.es