Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032358 (C530008M07Rik)
Chromosomal location
Chr 9: 76337861 - 76393653 (-)
Description
RIKEN cDNA C530008M07 gene Gene [Source:MGI Symbol;Acc:MGI:2685362]
RefSeq_dna
NM_001045518 
RefSeq_peptide
NP_001038983.1 
UniGene
Mm.256929 
MGI
MGI:2685362 
Uniprot/SWISSPROT
Q0VBM2 
Human Ortholog
ENSG00000168143 (FAM83B)
Omim not available
UniTrap UNI14043
Vector Insertion
Chr 9: 76350990 - 76393146
Public Clones CMHD-GT_129G1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098546
Sequence
CAGGTACCTCTTGCCTCTGCCCAGATGAACATTTGAAAGTTCCCCTCATCCAACACCAGCAACATGGAGGCTTCATCAATGCTTTCATCACTAAATGATG

AGTGCCGATCTGACAACTATGTCGAGCCGCACTACAAGGAGTGGTATCGCGTGGCAGTTGATACTCTAATTGAACATGGGTTAGAAGCCTACCAAGAGTT

TCTCATCAAGGAGCGAGTTTCAGACTTTCTGGCAGAGGAAGAGATTAATTATATTTTGAAAAATGTCCAGAAGATTGCACAAAATACAGAACATGGTTCT

GATAGTTCCTGTGATGACGGCTCGTCTTCAGGGACTTACTGGCCCATGCAGTCTGATGTGGAGGCTCCAAATCTTGATCTAGGCTGGCCATACGTGATGC

CCGGACTCTTAGGGAGTACCCACATAGACCTCCTCTTTCACCCACCAAGGGCACATCTGCTTACAATAAAGGAAACTATTCGGAAGATGATCAAAGAAGC

GAGAAAG - UNI14043 - GTGGTTGCTATAGTGATGGATGTGTTTACTGATGTGGATATTTTCAAAGAAATAGTAGAGGCATCAACACGAGGAATAT

CTGTGTACATTCTACTTGATGAGTCCAATTTTAGTCATTTTCTAACAATGACTGAAAAACAGGGTTGTCAAATTCAACGTCTCAGG AACATTCGCATAC

GGACAGTAAAAGGTCAAGATTATCTTTCAAAAACAGGAGCAAAATTCCACGGAAAAATGGAACAGAAATTTTTGCTAGTTGACTGCCAGAAAGTGATGTA

TGGGTCTTACAG TTACATGTGGTCATTTGAGAAAGCTCATCTCAGCATGGTTCAGATAATCACAGGCCACCTCGTAGAGTTATTTGATGAAGAATTTCG

AACACTCTATGCTAGGTCCTCTGTCCCAAGTTCTTTTGCTCAGGAAGAATCGGTGAGGGCAAAGCCAGGCAAAGCCTTGTGGGAGAATGGCATTTACCAG

CGATCCATTTCTTCATTAGCTTCCGTTTCCAGCCAGAGAAACCTTTTTGGCAGACAAGACCAAATTCATAAACTAGATTCTAGTTACTTCAAAGGCAGAG

GGATATATCCTCTAAATGATCAGGACAAACACAGCATGAGAAACCATGGCTACAAACCTCATTTTGTTCCAAACTTCAATGGTCCAAGTACAATCCGCCA

CTTCCAACCCAGTCAGCTCAATGAAAACTGGAAGAGGCATAGCTATGCTGGGGAACAACCGGAAACAACACCGTACCTGCTGCTCAACAGAGCTATGAAT

CGGACCAATAATGCTCCTGGACGCTGGCGAAGGCCTTCAGACAGTCTCAGTGTAGCATCCTCATTAAGGGGAGGACAAGGAAGCCAGCAAAACATACCAG

CTCAGAGTTTTGCTGATCGGCTTGCCCAGAGAAAAACCACAAATCTTGCAGAGAGGAATTCAAATGTACGCAGGTCATTTAACGGGACAGATAATCATAT

CCGCTTTATACAACAACGGATGCCAACTCTGGAGAATACCACGAAGTCTTTCCTGCGGAGCTGGAGAATTGAATCGTACTTAAATGACAATTCAGAAGTC

CCACCTGATTCAAATGGTTCCACCCTGGGTGACAGATTTGAAGGCTACGAAAACCCTGAGGCCGTGAAAGCCAATGCACTCTATACTCACTCGAGGCTCC

GCTCCTCGTTTGTGTTTAAACCAACTTTACCGGAACAAAAAGAAGTCAACAGCTGTACAACTGGCTCTTCAAATTCCACCATCATCGGTTCTCAAGGAAG

CGATACACCTAATGAGGTCCCAGATACCTCCACAAATGCACCGCCCTTGACAGAAAAACCTTTGCCTGAACCAAGCTCCAAGCTCCCAACACAACAAGAG

GAACCAAAAATGCACAACTTGCAGGTTCCCGAAAAGCAACCAGAAGCCTTAAACCAAAGAACAAATGGCCGAGCAGAATTAAACAACTGTATCTATACAA

ACCTGTGTGTCAATAAGCAGAGGGAGAACACAGAAAATCAGCAAAATGACAATCTGCTCAAAAGGCGCAGTTTCCCGTCCTTTGACCACTCGAAGGTCAA

TTTAGAGCATGGGAATAGCAAGAATTATGTTTATAGTACCCTTACCAGAAATCGGATTCGACAACCAGAAAAACCCAAGGAGGTTGTGCTGAAGAGCTCT

AAAAGCATGCACAACGTGACCCACAGCGCAGAGGAAGATGATGACGAGGTTATCGAGAGAGACCCTCCAAGTGCCTCTGCCACCAAATCTATTTCCATTG

CTGCTTTGCTTGATGTGAATAAGGAAGAACCCAACAAAGAGCCTAATTCTAAAAAGGAAGGCAAAGCCTCCCCGAGTTTTTTGAAAAAGGGGTCTCAGAA

ATTAAGGTCCTTACTTAGTCTCACCCCAGAAAAGAGAGAAAGCCTAGCTAAAAACAAGGCGCCCGCATTTTATAGAATGTGTAGTAGCTCTGACACTTTG

GTTTCTGAGGGTGAAGAGAATCAAAAGCCCAAAAAATCCGAACCCAAAGTTGATTCATCTCCCAGAAGAAAGCGTTCCTCCTCGTCAAATTCTCAAGGCA

GCATCCACAAGAGCAAGGAGGACATAGCGGTTAGCGCCTCTCCAGGGATAAGTTCCCAAGCTGAGGAAAGTAGAAGAATAGCGCCTTCTCCGAGGCCCGT

TGAGAGGAGACTTTCCGAGAGAGCGGGAGATGCCTCCGCCCCAAGATTTAATACCGAACAGATCCAATACCGGGATTCCAAGGAGATCAGCTCACTCATG

ACCCCTGCCAGACGGCCAACACCTTCTCCGGTGCTAAAGCCCAATGAGCTTCTAAGATCTCATTCCACCAACCAGCGAGTTTACAGTCGATTCGAGCCAT

TTTGTAAGATTGAGAGCTCTATTCAGCCAGCGAGCAGCGTTACAAATACACATGTCAACCGCCCAGAAGTCAAATCCTCAACCATGGGCACCGCTTATGG

CAGGTCCAGCCCAATGTTGAATTATAAGACTGGTGCTTATCATTCATACGCCCCCAATGAAAACAAGTTCCGGGGATTTATGCAAAAGTTCGGAAACTTC

ATACACAAAAACAAGTGAAATACTTCCGTTTCAAATGGCAATTGAAATATACAATGAATGTAGCTGTAAATATTTGCCCAAAGAACACTCTGCACATTTT

TTTTTGTATCATGCCAAGAGTTTTCTATATGAGAACTGGGTAAATGTATAACAGTATACAGAAAAATTACTGTTTTGGGCTAAAATTAGTTGTACTTGGT

TACCCCACAAAGGACTATCCTAGTAAATACATTAAAATTTTTGTTTTTAAATAGCTGTAGATGGGATTCATTGTGTCCTATCTATTAAAAATCTTGTGTT

TGATTAGAAGAAATCTCAGTGGAGAAGACAGACTACATTTGGATTTTATCATTCATTCCAGTCTTCATATAAAAACAGTTCATAATACTTATCACTGGTG

CTTTTTATAAACCTTTATGATTTTTTTCATATTTTCAGAGACACAAGGAAACACAACAAACCCTTTTTGTTGTTACACTCTATAGACTAACTTAATATGT

TTTATTGTCCTATTATGTTTCCTGTGCAGCACTGAACAAAGTATCGTTTAAATTCTGTAGGCCAGTGTGCTTATTGAGCCTGCAGTGTGTTTGCACTTCT

GTACATCAGCATTAAGCATCAGCCTTGCATATTGCACACACACAGGCTTTATTTTCTAACCTGTAGGTACTGTGCAGTGTTCTGCTTTGCACTGCCCATC

TCTTGTAGTCCTTCCTTAATTAAAATTTAAAGCAAGTGAACAGCC
Translation
MEASSMLSSLNDECRSDNYVEPHYKEWYRVAVDTLIEHGLEAYQEFLIKERVSDFLAEEEINYILKNVQKIAQNTEHGSDSSCDDGSSSGTYWPMQSDVE

APNLDLGWPYVMPGLLGSTHIDLLFHPPRAHLLTIKETIRKMIKEARK - UNI14043 - VVAIVMDVFTDVDIFKEIVEASTRGISVYILLDESNFS

HFLTMTEKQGCQIQRLR NIRIRTVKGQDYLSKTGAKFHGKMEQKFLLVDCQKVMYGSYS SYMWSFEKAHLSMVQIITGHLVELFDEEFRTLYARSSVP

SSFAQEESVRAKPGKALWENGIYQRSISSLASVSSQRNLFGRQDQIHKLDSSYFKGRGIYPLNDQDKHSMRNHGYKPHFVPNFNGPSTIRHFQPSQLNEN

WKRHSYAGEQPETTPYLLLNRAMNRTNNAPGRWRRPSDSLSVASSLRGGQGSQQNIPAQSFADRLAQRKTTNLAERNSNVRRSFNGTDNHIRFIQQRMPT

LENTTKSFLRSWRIESYLNDNSEVPPDSNGSTLGDRFEGYENPEAVKANALYTHSRLRSSFVFKPTLPEQKEVNSCTTGSSNSTIIGSQGSDTPNEVPDT

STNAPPLTEKPLPEPSSKLPTQQEEPKMHNLQVPEKQPEALNQRTNGRAELNNCIYTNLCVNKQRENTENQQNDNLLKRRSFPSFDHSKVNLEHGNSKNY

VYSTLTRNRIRQPEKPKEVVLKSSKSMHNVTHSAEEDDDEVIERDPPSASATKSISIAALLDVNKEEPNKEPNSKKEGKASPSFLKKGSQKLRSLLSLTP

EKRESLAKNKAPAFYRMCSSSDTLVSEGEENQKPKKSEPKVDSSPRRKRSSSSNSQGSIHKSKEDIAVSASPGISSQAEESRRIAPSPRPVERRLSERAG

DASAPRFNTEQIQYRDSKEISSLMTPARRPTPSPVLKPNELLRSHSTNQRVYSRFEPFCKIESSIQPASSVTNTHVNRPEVKSSTMGTAYGRSSPMLNYK

TGAYHSYAPNENKFRGFMQKFGNFIHKNK

For any suggestions or comments, please send an email to unitrap@crg.es